Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4996460..4997080 | Replicon | chromosome |
Accession | NZ_LR699006 | ||
Organism | Citrobacter freundii isolate MGYG-HGUT-02495 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | FYB80_RS23850 | Protein ID | WP_002892050.1 |
Coordinates | 4996862..4997080 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | - |
Locus tag | FYB80_RS23845 | Protein ID | WP_047413009.1 |
Coordinates | 4996460..4996834 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FYB80_RS23835 | 4991606..4992799 | + | 1194 | WP_043015418.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
FYB80_RS23840 | 4992822..4995971 | + | 3150 | WP_043015417.1 | multidrug efflux RND transporter permease subunit | - |
FYB80_RS23845 | 4996460..4996834 | + | 375 | WP_047413009.1 | Hha toxicity modulator TomB | Antitoxin |
FYB80_RS23850 | 4996862..4997080 | + | 219 | WP_002892050.1 | hemolysin expression modulator Hha | Toxin |
FYB80_RS23855 | 4997261..4997812 | + | 552 | WP_043015416.1 | maltose O-acetyltransferase | - |
FYB80_RS23860 | 4997929..4998399 | + | 471 | WP_043015415.1 | YlaC family protein | - |
FYB80_RS23865 | 4998479..4998619 | - | 141 | WP_005125190.1 | type B 50S ribosomal protein L36 | - |
FYB80_RS23870 | 4998621..4998881 | - | 261 | WP_043015414.1 | type B 50S ribosomal protein L31 | - |
FYB80_RS23875 | 4999070..5000623 | + | 1554 | WP_047413013.1 | EAL domain-containing protein | - |
FYB80_RS23880 | 5000675..5001028 | - | 354 | WP_003831033.1 | DUF1428 family protein | - |
FYB80_RS23885 | 5001093..5001722 | - | 630 | WP_043015412.1 | membrane protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T288737 WP_002892050.1 NZ_LR699006:4996862-4997080 [Citrobacter freundii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14441.26 Da Isoelectric Point: 5.5716
>AT288737 WP_047413009.1 NZ_LR699006:4996460-4996834 [Citrobacter freundii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEENKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEENKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|