Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 2107404..2108058 | Replicon | chromosome |
| Accession | NZ_LR699006 | ||
| Organism | Citrobacter freundii isolate MGYG-HGUT-02495 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | FYB80_RS10110 | Protein ID | WP_043017506.1 |
| Coordinates | 2107651..2108058 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | R8WMJ6 |
| Locus tag | FYB80_RS10105 | Protein ID | WP_016154349.1 |
| Coordinates | 2107404..2107670 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FYB80_RS10075 | 2102607..2104040 | - | 1434 | WP_043017510.1 | 6-phospho-beta-glucosidase BglA | - |
| FYB80_RS10080 | 2104160..2104888 | - | 729 | WP_008785744.1 | MurR/RpiR family transcriptional regulator | - |
| FYB80_RS10085 | 2104941..2105252 | + | 312 | WP_047408909.1 | N(4)-acetylcytidine aminohydrolase | - |
| FYB80_RS10090 | 2105416..2106075 | + | 660 | WP_043017508.1 | hemolysin III family protein | - |
| FYB80_RS10095 | 2106167..2107147 | - | 981 | WP_047408911.1 | tRNA-modifying protein YgfZ | - |
| FYB80_RS10105 | 2107404..2107670 | + | 267 | WP_016154349.1 | FAD assembly factor SdhE | Antitoxin |
| FYB80_RS10110 | 2107651..2108058 | + | 408 | WP_043017506.1 | protein YgfX | Toxin |
| FYB80_RS10115 | 2108158..2108679 | - | 522 | WP_043017505.1 | flavodoxin FldB | - |
| FYB80_RS10120 | 2108793..2109689 | + | 897 | WP_003825519.1 | site-specific tyrosine recombinase XerD | - |
| FYB80_RS10125 | 2109713..2110426 | + | 714 | WP_043017504.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| FYB80_RS10130 | 2110432..2112165 | + | 1734 | WP_047408916.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15891.76 Da Isoelectric Point: 11.5692
>T288730 WP_043017506.1 NZ_LR699006:2107651-2108058 [Citrobacter freundii]
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMNGRLRWQGQ
EWSIVSAPWMVKTGMMLRLRSDVGKRQHLWLAADSMDDAEWRDLRRLILQQAKQG
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMNGRLRWQGQ
EWSIVSAPWMVKTGMMLRLRSDVGKRQHLWLAADSMDDAEWRDLRRLILQQAKQG
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|