Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 1959411..1960214 | Replicon | chromosome |
Accession | NZ_LR699006 | ||
Organism | Citrobacter freundii isolate MGYG-HGUT-02495 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A6N6JYU3 |
Locus tag | FYB80_RS09390 | Protein ID | WP_024156451.1 |
Coordinates | 1959411..1959791 (-) | Length | 127 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | FYB80_RS09395 | Protein ID | WP_047408718.1 |
Coordinates | 1959849..1960214 (-) | Length | 122 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FYB80_RS09365 | 1955285..1955764 | + | 480 | WP_047408701.1 | Hcp family type VI secretion system effector | - |
FYB80_RS09370 | 1955993..1956775 | - | 783 | WP_047408704.1 | hypothetical protein | - |
FYB80_RS09375 | 1957766..1958614 | - | 849 | WP_047408707.1 | DUF4942 domain-containing protein | - |
FYB80_RS09385 | 1958923..1959414 | - | 492 | WP_047408710.1 | hypothetical protein | - |
FYB80_RS09390 | 1959411..1959791 | - | 381 | WP_024156451.1 | TA system toxin CbtA family protein | Toxin |
FYB80_RS09395 | 1959849..1960214 | - | 366 | WP_047408718.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
FYB80_RS09400 | 1960236..1960457 | - | 222 | WP_043017585.1 | DUF987 domain-containing protein | - |
FYB80_RS09405 | 1960471..1960950 | - | 480 | WP_047408722.1 | DNA repair protein RadC | - |
FYB80_RS09410 | 1960963..1961436 | - | 474 | WP_047413366.1 | antirestriction protein | - |
FYB80_RS09420 | 1961705..1962523 | - | 819 | WP_047408730.1 | DUF945 domain-containing protein | - |
FYB80_RS09425 | 1962641..1962892 | - | 252 | WP_047413368.1 | DUF905 family protein | - |
FYB80_RS09430 | 1962982..1963515 | - | 534 | WP_024156443.1 | DUF4234 domain-containing protein | - |
FYB80_RS09435 | 1963579..1964046 | - | 468 | WP_043017583.1 | hypothetical protein | - |
FYB80_RS09440 | 1964143..1964544 | - | 402 | WP_043017582.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 14263.44 Da Isoelectric Point: 10.0919
>T288729 WP_024156451.1 NZ_LR699006:c1959791-1959411 [Citrobacter freundii]
MQTLSAIPKRKAPSRPTPVEIWQQLLTYLLKRHYGLSLSDTQFSDEEIITQYIDAGISLSDALNFLVEKSELVRIDRPGF
SIKHQSPFIGVIDILRARRATGLMQRNGYKRITLLIAGNAAQEQHS
MQTLSAIPKRKAPSRPTPVEIWQQLLTYLLKRHYGLSLSDTQFSDEEIITQYIDAGISLSDALNFLVEKSELVRIDRPGF
SIKHQSPFIGVIDILRARRATGLMQRNGYKRITLLIAGNAAQEQHS
Download Length: 381 bp
Antitoxin
Download Length: 122 a.a. Molecular weight: 13397.25 Da Isoelectric Point: 6.2044
>AT288729 WP_047408718.1 NZ_LR699006:c1960214-1959849 [Citrobacter freundii]
MSNPIPPVNHDVSEPWWGLKPGITPCFGARLVQEGNRLHYLADRASIAGVFSDADLRHLDQAFPVLLKQLELMLVSGELN
PRHQHCVTLYAKGLTCEADSLGSHGYIYTAIYPTPDDSITR
MSNPIPPVNHDVSEPWWGLKPGITPCFGARLVQEGNRLHYLADRASIAGVFSDADLRHLDQAFPVLLKQLELMLVSGELN
PRHQHCVTLYAKGLTCEADSLGSHGYIYTAIYPTPDDSITR
Download Length: 366 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|