Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 1424356..1424942 Replicon chromosome
Accession NZ_LR699006
Organism Citrobacter freundii isolate MGYG-HGUT-02495

Toxin (Protein)


Gene name doc Uniprot ID -
Locus tag FYB80_RS06840 Protein ID WP_047408095.1
Coordinates 1424574..1424942 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID -
Locus tag FYB80_RS06835 Protein ID WP_032945249.1
Coordinates 1424356..1424577 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FYB80_RS06805 1419719..1420996 + 1278 WP_043018609.1 branched chain amino acid ABC transporter permease LivM -
FYB80_RS06810 1420993..1421760 + 768 WP_047408088.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
FYB80_RS06815 1421778..1422491 + 714 WP_087050797.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
FYB80_RS06820 1422619..1423365 + 747 WP_043018608.1 hypothetical protein -
FYB80_RS06825 1423468..1423749 + 282 WP_043018607.1 hypothetical protein -
FYB80_RS06830 1423890..1424297 + 408 WP_047408091.1 hypothetical protein -
FYB80_RS06835 1424356..1424577 + 222 WP_032945249.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
FYB80_RS06840 1424574..1424942 + 369 WP_047408095.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
FYB80_RS06845 1425200..1426516 + 1317 WP_043018605.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
FYB80_RS06850 1426619..1427506 + 888 WP_043018604.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
FYB80_RS06855 1427503..1428348 + 846 WP_003023450.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
FYB80_RS06860 1428616..1429686 + 1071 WP_047408101.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1419719..1430426 10707


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-121)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13503.78 Da        Isoelectric Point: 6.7249

>T288727 WP_047408095.1 NZ_LR699006:1424574-1424942 [Citrobacter freundii]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEALMYRVLNQIEYEGVTDVWLMAAMHLLAISRGHIFNDSNKRTALF
ITLLFLKRNGIAVPANPDFVAMTVEAAAGQLTLEQIASRLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8292.38 Da        Isoelectric Point: 4.7906

>AT288727 WP_032945249.1 NZ_LR699006:1424356-1424577 [Citrobacter freundii]
MRTMNYSEARQNLAEVLESAVTGVPVTITRRGHKPAVIISAEEFERYQAARLDDEFADIMMVHGNEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References