Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 692168..692703 | Replicon | chromosome |
Accession | NZ_LR699006 | ||
Organism | Citrobacter freundii isolate MGYG-HGUT-02495 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | FYB80_RS03390 | Protein ID | WP_047406935.1 |
Coordinates | 692416..692703 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | D4BKM9 |
Locus tag | FYB80_RS03385 | Protein ID | WP_006688247.1 |
Coordinates | 692168..692419 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FYB80_RS03345 | 687351..688037 | + | 687 | WP_047413307.1 | phosphonate C-P lyase system protein PhnL | - |
FYB80_RS03350 | 688034..689170 | + | 1137 | WP_047406916.1 | alpha-D-ribose 1-methylphosphonate 5-triphosphate diphosphatase | - |
FYB80_RS03355 | 689173..689727 | + | 555 | WP_043018118.1 | ribose 1,5-bisphosphokinase | - |
FYB80_RS03360 | 689714..690148 | + | 435 | WP_043018117.1 | aminoalkylphosphonate N-acetyltransferase | - |
FYB80_RS03365 | 690157..690915 | + | 759 | WP_047406919.1 | phosphonate metabolism protein PhnP | - |
FYB80_RS03370 | 690984..691469 | + | 486 | WP_047406923.1 | membrane protein | - |
FYB80_RS03375 | 691538..691789 | + | 252 | WP_047406926.1 | hypothetical protein | - |
FYB80_RS03380 | 691761..692090 | + | 330 | WP_047406929.1 | phosphotyrosine protein phosphatase | - |
FYB80_RS03385 | 692168..692419 | + | 252 | WP_006688247.1 | plasmid stabilization protein | Antitoxin |
FYB80_RS03390 | 692416..692703 | + | 288 | WP_047406935.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
FYB80_RS03395 | 692700..693026 | - | 327 | WP_047406937.1 | hypothetical protein | - |
FYB80_RS03400 | 693096..695360 | - | 2265 | WP_047406940.1 | hybrid sensor histidine kinase/response regulator | - |
FYB80_RS03410 | 695475..696998 | + | 1524 | WP_047406943.1 | sugar ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11074.03 Da Isoelectric Point: 10.2540
>T288725 WP_047406935.1 NZ_LR699006:692416-692703 [Citrobacter freundii]
MSYTVKFREDALKEWQKLDLAIQQQFAKKLKKCCENPHVPSAKLRGIKDCYKIKLRTSGFRLVYQVIDDTLVIAVVAVGK
RERSEVYNLASERLR
MSYTVKFREDALKEWQKLDLAIQQQFAKKLKKCCENPHVPSAKLRGIKDCYKIKLRTSGFRLVYQVIDDTLVIAVVAVGK
RERSEVYNLASERLR
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|