Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 398893..399664 | Replicon | chromosome |
Accession | NZ_LR699006 | ||
Organism | Citrobacter freundii isolate MGYG-HGUT-02495 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | - |
Locus tag | FYB80_RS01865 | Protein ID | WP_047406475.1 |
Coordinates | 398893..399282 (-) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | FYB80_RS01870 | Protein ID | WP_172626128.1 |
Coordinates | 399338..399664 (-) | Length | 109 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FYB80_RS01835 | 394138..394500 | + | 363 | WP_047406455.1 | endoribonuclease SymE | - |
FYB80_RS01840 | 394546..395181 | - | 636 | WP_047406458.1 | HNH endonuclease | - |
FYB80_RS01845 | 395322..396194 | + | 873 | WP_047406461.1 | HNH endonuclease | - |
FYB80_RS01850 | 396316..397119 | - | 804 | WP_047406464.1 | helix-turn-helix transcriptional regulator | - |
FYB80_RS01855 | 397497..397895 | - | 399 | WP_047406467.1 | hypothetical protein | - |
FYB80_RS01860 | 397964..398806 | - | 843 | WP_047406472.1 | DUF4942 domain-containing protein | - |
FYB80_RS01865 | 398893..399282 | - | 390 | WP_047406475.1 | TA system toxin CbtA family protein | Toxin |
FYB80_RS01870 | 399338..399664 | - | 327 | WP_172626128.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
FYB80_RS01875 | 399722..399943 | - | 222 | WP_047406482.1 | DUF987 domain-containing protein | - |
FYB80_RS01880 | 399958..400437 | - | 480 | WP_047406484.1 | DNA repair protein RadC | - |
FYB80_RS01885 | 400449..400898 | - | 450 | WP_047406487.1 | antirestriction protein | - |
FYB80_RS01890 | 400931..401752 | - | 822 | WP_047406489.1 | DUF945 domain-containing protein | - |
FYB80_RS01895 | 402043..403029 | - | 987 | WP_047406493.1 | hypothetical protein | - |
FYB80_RS01900 | 403029..403211 | - | 183 | WP_047406496.1 | hypothetical protein | - |
FYB80_RS01905 | 403864..404475 | + | 612 | WP_047413280.1 | inovirus Gp2 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 397497..417672 | 20175 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 14545.68 Da Isoelectric Point: 10.2738
>T288724 WP_047406475.1 NZ_LR699006:c399282-398893 [Citrobacter freundii]
MQTKSSQLMREALSRPSAVGVWQTLLTFLLEHHYGLTLNDTPFSHEQVIQQHIDAGISLADALNFIVEKYELLRTDRPGF
SILTQSPFITPIDILRARKATGLMNRGTYKEVTAITRGQHPQARTSGKR
MQTKSSQLMREALSRPSAVGVWQTLLTFLLEHHYGLTLNDTPFSHEQVIQQHIDAGISLADALNFIVEKYELLRTDRPGF
SILTQSPFITPIDILRARKATGLMNRGTYKEVTAITRGQHPQARTSGKR
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|