Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PemK-RelB |
Location | 1073438..1073993 | Replicon | chromosome |
Accession | NZ_LR699003 | ||
Organism | Bifidobacterium breve isolate MGYG-HGUT-02469 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | S2ZXD7 |
Locus tag | FX083_RS04670 | Protein ID | WP_003829109.1 |
Coordinates | 1073438..1073761 (-) | Length | 108 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S2ZDC4 |
Locus tag | FX083_RS04675 | Protein ID | WP_003829112.1 |
Coordinates | 1073748..1073993 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FX083_RS04635 | 1068466..1068764 | - | 299 | Protein_864 | IS256 family transposase | - |
FX083_RS04645 | 1069234..1070499 | - | 1266 | WP_015438706.1 | Fic family protein | - |
FX083_RS04655 | 1071041..1071406 | - | 366 | WP_025299744.1 | YccF domain-containing protein | - |
FX083_RS04660 | 1071644..1072513 | + | 870 | WP_003829104.1 | class I SAM-dependent methyltransferase | - |
FX083_RS04665 | 1072607..1073221 | + | 615 | WP_003829107.1 | cupin domain-containing protein | - |
FX083_RS04670 | 1073438..1073761 | - | 324 | WP_003829109.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
FX083_RS04675 | 1073748..1073993 | - | 246 | WP_003829112.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
FX083_RS04680 | 1074165..1075421 | + | 1257 | WP_015438708.1 | HipA domain-containing protein | - |
FX083_RS04685 | 1075687..1075865 | + | 179 | Protein_872 | XRE family transcriptional regulator | - |
FX083_RS04690 | 1076049..1077320 | - | 1272 | WP_003829121.1 | MFS transporter | - |
FX083_RS04695 | 1077477..1077686 | - | 210 | Protein_874 | TetR/AcrR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1063206..1080728 | 17522 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 11859.67 Da Isoelectric Point: 5.0771
>T288721 WP_003829109.1 NZ_LR699003:c1073761-1073438 [Bifidobacterium breve]
MKRGEIWTLQADGYASKPRPVVIVQSDAVDRFDSVITCLLTSYDSSDIDTRVRLEPSPENGLNKVSYVMTDKIVTVDRKL
LGYQVGVVDDAAMANIGRQLMRVLGLL
MKRGEIWTLQADGYASKPRPVVIVQSDAVDRFDSVITCLLTSYDSSDIDTRVRLEPSPENGLNKVSYVMTDKIVTVDRKL
LGYQVGVVDDAAMANIGRQLMRVLGLL
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A087B6Q7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A087B6Q6 |