Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 405402..405889 Replicon chromosome
Accession NZ_LR699000
Organism Candidatus Methanomethylophilus alvus isolate MGYG-HGUT-02456

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag FX051_RS02190 Protein ID WP_015504335.1
Coordinates 405623..405889 (+) Length 89 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag FX051_RS02185 Protein ID WP_022532204.1
Coordinates 405402..405626 (+) Length 75 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FX051_RS02145 400698..400892 + 195 WP_015504330.1 transcription elongation factor subunit Spt4 -
FX051_RS02150 400892..401407 + 516 WP_015504331.1 DUF359 domain-containing protein -
FX051_RS02155 401404..401724 + 321 WP_015504332.1 30S ribosomal protein S24e -
FX051_RS02160 401730..401918 + 189 WP_015504333.1 30S ribosomal protein S27ae -
FX051_RS02170 402531..402848 + 318 WP_147525264.1 nucleotidyltransferase domain-containing protein -
FX051_RS02180 403324..405042 - 1719 WP_048097697.1 transposase -
FX051_RS02185 405402..405626 + 225 WP_022532204.1 DUF6290 family protein Antitoxin
FX051_RS02190 405623..405889 + 267 WP_015504335.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
FX051_RS02195 406724..407200 + 477 WP_015504336.1 hypothetical protein -
FX051_RS02200 407712..408095 + 384 WP_052309267.1 DUF3990 domain-containing protein -
FX051_RS02205 408184..408420 + 237 WP_015504338.1 hypothetical protein -
FX051_RS02210 408420..408617 + 198 WP_015504339.1 DUF3791 domain-containing protein -
FX051_RS02215 408677..409192 - 516 WP_015504340.1 DUF4443 domain-containing protein -
FX051_RS02220 409387..410841 + 1455 WP_015504341.1 ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-87)

Antitoxin

Protein of unknown function DUF6290

(1-69)


Sequences

Toxin        


Download         Length: 89 a.a.        Molecular weight: 10242.86 Da        Isoelectric Point: 10.0403

>T288720 WP_015504335.1 NZ_LR699000:405623-405889 [Candidatus Methanomethylophilus alvus]
VSYSVEYTYDAIKQLRKMDRFTRTMILNWISKHLDGTDNPFASGKALTGDKVGLWRYRVGDYRLISKIDKGKLVILLVEI
GHRSNMYD

Download         Length: 267 bp

Antitoxin


Download         Length: 75 a.a.        Molecular weight: 8544.64 Da        Isoelectric Point: 4.2815

>AT288720 WP_022532204.1 NZ_LR699000:405402-405626 [Candidatus Methanomethylophilus alvus]
MAFSIRLTEDEEILARRYAALMGVSMGEAFKQALFEKIEDEYDIAVGEAAYRRYLDNPKTYSHAEVLKMFGDEE

Download         Length: 225 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References