Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 1261762..1262367 | Replicon | chromosome |
| Accession | NZ_LR698998 | ||
| Organism | Paenibacillus odorifer isolate MGYG-HGUT-02414 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A1R0YSQ6 |
| Locus tag | FYB94_RS05470 | Protein ID | WP_036686777.1 |
| Coordinates | 1262017..1262367 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | FYB94_RS05465 | Protein ID | WP_154117276.1 |
| Coordinates | 1261762..1262013 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FYB94_RS05445 | 1257147..1258532 | + | 1386 | WP_111502784.1 | helix-turn-helix transcriptional regulator | - |
| FYB94_RS05450 | 1258681..1258854 | + | 174 | WP_111502786.1 | aspartyl-phosphate phosphatase Spo0E family protein | - |
| FYB94_RS05455 | 1259061..1260146 | + | 1086 | WP_076137665.1 | outer membrane lipoprotein carrier protein LolA | - |
| FYB94_RS05460 | 1260335..1261516 | + | 1182 | WP_076137663.1 | alanine racemase | - |
| FYB94_RS05465 | 1261762..1262013 | + | 252 | WP_154117276.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
| FYB94_RS05470 | 1262017..1262367 | + | 351 | WP_036686777.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| FYB94_RS05475 | 1262576..1263133 | + | 558 | WP_172628782.1 | TetR family transcriptional regulator | - |
| FYB94_RS05480 | 1263305..1264504 | + | 1200 | WP_076137661.1 | MFS transporter | - |
| FYB94_RS05485 | 1264744..1266906 | + | 2163 | WP_179088937.1 | RNA-binding transcriptional accessory protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12778.71 Da Isoelectric Point: 5.1284
>T288719 WP_036686777.1 NZ_LR698998:1262017-1262367 [Paenibacillus odorifer]
MIVKRGDVFFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAAAHGFDRDSVILLEQV
RTIDKQRLTDKITHLDDETMKKVDESLQISLGLIDF
MIVKRGDVFFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAAAHGFDRDSVILLEQV
RTIDKQRLTDKITHLDDETMKKVDESLQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|