Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-RelB |
Location | 302451..303022 | Replicon | chromosome |
Accession | NZ_LR698990 | ||
Organism | Bifidobacterium adolescentis isolate MGYG-HGUT-02395 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | FX023_RS01180 | Protein ID | WP_003807675.1 |
Coordinates | 302451..302750 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0C2Z6P7 |
Locus tag | FX023_RS01185 | Protein ID | WP_034984155.1 |
Coordinates | 302750..303022 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FX023_RS01170 | 299116..299844 | + | 729 | WP_003807670.1 | type 1 glutamine amidotransferase | - |
FX023_RS01175 | 300156..302354 | + | 2199 | WP_039774710.1 | ABC-F family ATP-binding cassette domain-containing protein | - |
FX023_RS01180 | 302451..302750 | - | 300 | WP_003807675.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
FX023_RS01185 | 302750..303022 | - | 273 | WP_034984155.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
FX023_RS01190 | 303136..303972 | - | 837 | WP_039774711.1 | hypothetical protein | - |
FX023_RS01195 | 304156..304695 | + | 540 | WP_003807679.1 | hypothetical protein | - |
FX023_RS01200 | 304688..305206 | + | 519 | WP_130082043.1 | hypothetical protein | - |
FX023_RS01205 | 305265..306419 | - | 1155 | WP_046998989.1 | ATP-binding protein | - |
FX023_RS01210 | 306422..307051 | - | 630 | WP_039774712.1 | response regulator transcription factor | - |
FX023_RS01215 | 307188..307829 | + | 642 | WP_039774713.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11662.09 Da Isoelectric Point: 8.0955
>T288718 WP_003807675.1 NZ_LR698990:c302750-302451 [Bifidobacterium adolescentis]
MGRLTADFAKAFSRDLKKNAKRRNWNLTELEKVIDLVVENTPETLEELRRRHNMHTLSGNWRGRYECHVANAGDWLVIWS
SNDSVAFFERTGSHDELFR
MGRLTADFAKAFSRDLKKNAKRRNWNLTELEKVIDLVVENTPETLEELRRRHNMHTLSGNWRGRYECHVANAGDWLVIWS
SNDSVAFFERTGSHDELFR
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|