Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 1250684..1251286 | Replicon | chromosome |
Accession | NZ_LR698987 | ||
Organism | Leminorella richardii isolate MGYG-HGUT-02385 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | FX055_RS05925 | Protein ID | WP_197708850.1 |
Coordinates | 1250684..1250863 (+) | Length | 60 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | FX055_RS05930 | Protein ID | WP_111739802.1 |
Coordinates | 1250876..1251286 (+) | Length | 137 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FX055_RS05905 | 1246903..1247502 | + | 600 | WP_111739794.1 | adenylyl-sulfate kinase | - |
FX055_RS05910 | 1248092..1248865 | + | 774 | WP_111739796.1 | trans-aconitate 2-methyltransferase | - |
FX055_RS05915 | 1248907..1249896 | - | 990 | WP_111739798.1 | sulfate ABC transporter substrate-binding protein | - |
FX055_RS05920 | 1250096..1250500 | + | 405 | WP_111739800.1 | DUF1311 domain-containing protein | - |
FX055_RS05925 | 1250684..1250863 | + | 180 | WP_197708850.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
FX055_RS05930 | 1250876..1251286 | + | 411 | WP_111739802.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
FX055_RS05935 | 1251324..1251734 | + | 411 | WP_111739804.1 | Cu(I)-responsive transcriptional regulator | - |
FX055_RS05940 | 1252162..1253469 | + | 1308 | WP_111739806.1 | MFS transporter | - |
FX055_RS05945 | 1253866..1255731 | + | 1866 | WP_111742013.1 | SLC13 family permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6718.98 Da Isoelectric Point: 10.9132
>T288710 WP_197708850.1 NZ_LR698987:1250684-1250863 [Leminorella richardii]
MDSKNVIAMIEADGWYLVRIKGSHHQFKHPLKKGLVTVKHTQKDIPLPTLKSIKRQSGI
MDSKNVIAMIEADGWYLVRIKGSHHQFKHPLKKGLVTVKHTQKDIPLPTLKSIKRQSGI
Download Length: 180 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 14892.01 Da Isoelectric Point: 4.2860
>AT288710 WP_111739802.1 NZ_LR698987:1250876-1251286 [Leminorella richardii]
MLYPVAIDRGEESLGVRVPDIPGCFSGGDDYQDALISVKEAIEAHIELLVEDGDDVPAATNIERWLNDPEYAGAIWALVD
VDMVRLMGGAEKINVTLPKRLIAKIDRLVATRPEFKSRSGFLTQAALERISIVNNA
MLYPVAIDRGEESLGVRVPDIPGCFSGGDDYQDALISVKEAIEAHIELLVEDGDDVPAATNIERWLNDPEYAGAIWALVD
VDMVRLMGGAEKINVTLPKRLIAKIDRLVATRPEFKSRSGFLTQAALERISIVNNA
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|