Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 562534..563170 | Replicon | chromosome |
Accession | NZ_LR698983 | ||
Organism | Bacillus licheniformis isolate MGYG-HGUT-02357 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | M5P3Q9 |
Locus tag | FX000_RS02825 | Protein ID | WP_003179128.1 |
Coordinates | 562820..563170 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | M5PDU2 |
Locus tag | FX000_RS02820 | Protein ID | WP_006638778.1 |
Coordinates | 562534..562815 (+) | Length | 94 a.a. |
Genomic Context
Location: 557649..559130 (1482 bp)
Type: Others
Protein ID: WP_009330132.1
Type: Others
Protein ID: WP_009330132.1
Location: 560069..561028 (960 bp)
Type: Others
Protein ID: WP_152847888.1
Type: Others
Protein ID: WP_152847888.1
Location: 561253..562422 (1170 bp)
Type: Others
Protein ID: WP_026080763.1
Type: Others
Protein ID: WP_026080763.1
Location: 562534..562815 (282 bp)
Type: Antitoxin
Protein ID: WP_006638778.1
Type: Antitoxin
Protein ID: WP_006638778.1
Location: 562820..563170 (351 bp)
Type: Toxin
Protein ID: WP_003179128.1
Type: Toxin
Protein ID: WP_003179128.1
Location: 563288..564115 (828 bp)
Type: Others
Protein ID: WP_003179130.1
Type: Others
Protein ID: WP_003179130.1
Location: 564119..564484 (366 bp)
Type: Others
Protein ID: WP_003179132.1
Type: Others
Protein ID: WP_003179132.1
Location: 564487..564888 (402 bp)
Type: Others
Protein ID: WP_003179135.1
Type: Others
Protein ID: WP_003179135.1
Location: 564899..565906 (1008 bp)
Type: Others
Protein ID: WP_003179137.1
Type: Others
Protein ID: WP_003179137.1
Location: 565965..566291 (327 bp)
Type: Others
Protein ID: WP_003179140.1
Type: Others
Protein ID: WP_003179140.1
Location: 566291..566776 (486 bp)
Type: Others
Protein ID: WP_003179142.1
Type: Others
Protein ID: WP_003179142.1
Location: 566742..567533 (792 bp)
Type: Others
Protein ID: WP_003179144.1
Type: Others
Protein ID: WP_003179144.1
Location: 567530..568129 (600 bp)
Type: Others
Protein ID: WP_003179145.1
Type: Others
Protein ID: WP_003179145.1
Location: 559127..559726 (600 bp)
Type: Others
Protein ID: WP_003179118.1
Type: Others
Protein ID: WP_003179118.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FX000_RS02800 | 557649..559130 | + | 1482 | WP_009330132.1 | PH domain-containing protein | - |
FX000_RS02805 | 559127..559726 | - | 600 | WP_003179118.1 | rhomboid family intramembrane serine protease | - |
FX000_RS02810 | 560069..561028 | + | 960 | WP_152847888.1 | outer membrane lipoprotein carrier protein LolA | - |
FX000_RS02815 | 561253..562422 | + | 1170 | WP_026080763.1 | alanine racemase | - |
FX000_RS02820 | 562534..562815 | + | 282 | WP_006638778.1 | hypothetical protein | Antitoxin |
FX000_RS02825 | 562820..563170 | + | 351 | WP_003179128.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
FX000_RS02830 | 563288..564115 | + | 828 | WP_003179130.1 | RsbT co-antagonist protein RsbRA | - |
FX000_RS02835 | 564119..564484 | + | 366 | WP_003179132.1 | STAS domain-containing protein | - |
FX000_RS02840 | 564487..564888 | + | 402 | WP_003179135.1 | anti-sigma regulatory factor | - |
FX000_RS02845 | 564899..565906 | + | 1008 | WP_003179137.1 | PP2C family protein-serine/threonine phosphatase | - |
FX000_RS02850 | 565965..566291 | + | 327 | WP_003179140.1 | anti-sigma factor antagonist | - |
FX000_RS02855 | 566291..566776 | + | 486 | WP_003179142.1 | anti-sigma B factor RsbW | - |
FX000_RS02860 | 566742..567533 | + | 792 | WP_003179144.1 | RNA polymerase sigma factor SigB | - |
FX000_RS02865 | 567530..568129 | + | 600 | WP_003179145.1 | SpoIIE family protein phosphatase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12990.03 Da Isoelectric Point: 5.7234
>T288703 WP_003179128.1 NZ_LR698983:562820-563170 [Bacillus licheniformis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNNIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVNEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNNIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVNEALQISLALIDF
Download Length: 351 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6I7FHI4 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | M5PDU2 |