Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pasABC/RelE-HTH |
Location | 565588..566077 | Replicon | chromosome |
Accession | NZ_LR698979 | ||
Organism | Bifidobacterium thermophilum isolate MGYG-HGUT-02334 |
Toxin (Protein)
Gene name | pasB | Uniprot ID | M4RB99 |
Locus tag | FXZ37_RS02055 | Protein ID | WP_015449982.1 |
Coordinates | 565808..566077 (+) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | pasA | Uniprot ID | M4REW7 |
Locus tag | FXZ37_RS02050 | Protein ID | WP_015449981.1 |
Coordinates | 565588..565824 (+) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FXZ37_RS02045 | 564226..565308 | + | 1083 | WP_044282335.1 | hypothetical protein | - |
FXZ37_RS02050 | 565588..565824 | + | 237 | WP_015449981.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
FXZ37_RS02055 | 565808..566077 | + | 270 | WP_015449982.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
FXZ37_RS02060 | 566345..566986 | - | 642 | WP_081602282.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
FXZ37_RS02065 | 567004..567908 | + | 905 | Protein_402 | A/G-specific adenine glycosylase | - |
FXZ37_RS02070 | 567977..568558 | + | 582 | WP_052307709.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 558375..566944 | 8569 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10358.21 Da Isoelectric Point: 10.4616
>T288699 WP_015449982.1 NZ_LR698979:565808-566077 [Bifidobacterium thermophilum]
MAWKIEIDKGVQRSMKKLDRHVAKRIIAKLREISQLEDPRSTGKALVGNLAGLWRYRVGDYQIVCDIEDEVLLILVVDVA
HRSKVYKRR
MAWKIEIDKGVQRSMKKLDRHVAKRIIAKLREISQLEDPRSTGKALVGNLAGLWRYRVGDYQIVCDIEDEVLLILVVDVA
HRSKVYKRR
Download Length: 270 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|