Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yoeB-Axe/YoeB-RelB
Location 105394..105918 Replicon chromosome
Accession NZ_LR698979
Organism Bifidobacterium thermophilum isolate MGYG-HGUT-02334

Toxin (Protein)


Gene name yoeB Uniprot ID M4RDV8
Locus tag FXZ37_RS00390 Protein ID WP_015449616.1
Coordinates 105394..105654 (-) Length 87 a.a.

Antitoxin (Protein)


Gene name Axe Uniprot ID M4RA88
Locus tag FXZ37_RS00395 Protein ID WP_015449617.1
Coordinates 105658..105918 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FXZ37_RS00370 100741..101715 + 975 WP_015449610.1 zinc metalloprotease HtpX -
FXZ37_RS00375 101965..102810 + 846 WP_015449612.1 phosphatase PAP2 family protein -
FXZ37_RS00380 102922..103332 + 411 WP_015449613.1 peptide deformylase -
FXZ37_RS00385 103724..104905 - 1182 WP_015449614.1 aromatic amino acid DMT transporter YddG -
FXZ37_RS08755 105179..105337 - 159 WP_015449615.1 hypothetical protein -
FXZ37_RS00390 105394..105654 - 261 WP_015449616.1 Txe/YoeB family addiction module toxin Toxin
FXZ37_RS00395 105658..105918 - 261 WP_015449617.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
FXZ37_RS00405 106371..106538 - 168 WP_026650596.1 50S ribosomal protein L32 -
FXZ37_RS00410 106538..106660 - 123 WP_015449619.1 type B 50S ribosomal protein L36 -
FXZ37_RS00415 106657..107031 - 375 WP_015449620.1 type B 50S ribosomal protein L31 -
FXZ37_RS00420 107130..107435 - 306 WP_015449621.1 30S ribosomal protein S14 -
FXZ37_RS00425 107437..107604 - 168 WP_015449622.1 50S ribosomal protein L33 -
FXZ37_RS00430 107691..107930 - 240 WP_026650597.1 50S ribosomal protein L28 -
FXZ37_RS00435 107990..108853 + 864 WP_015449624.1 hypothetical protein -
FXZ37_RS00440 109289..110062 - 774 WP_015449625.1 SDR family NAD(P)-dependent oxidoreductase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(2-83)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(4-75)


Sequences

Toxin        


Download         Length: 87 a.a.        Molecular weight: 10213.57 Da        Isoelectric Point: 7.9936

>T288698 WP_015449616.1 NZ_LR698979:c105654-105394 [Bifidobacterium thermophilum]
MLRWTDDAWEDYLYWQSPDKRTLKRINALIRDAQRSPFEGIGKPEPLKWDFQGAWSRRIDSANRLIYMVADGDLCILSAR
DHYPGR

Download         Length: 261 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 10062.31 Da        Isoelectric Point: 5.6765

>AT288698 WP_015449617.1 NZ_LR698979:c105918-105658 [Bifidobacterium thermophilum]
MVTAVAYTNFRKDLKSYMRRVNDDADMLLVTNKDEHDNVVVMSASDYDSLMETLRVYQNQYLRNKVQRGMEQIREGAATQ
HDITKD

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB M4RDV8

Antitoxin

Source ID Structure
AlphaFold DB M4RA88

References