Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yoeB-Axe/YoeB-RelB |
| Location | 105394..105918 | Replicon | chromosome |
| Accession | NZ_LR698979 | ||
| Organism | Bifidobacterium thermophilum isolate MGYG-HGUT-02334 | ||
Toxin (Protein)
| Gene name | yoeB | Uniprot ID | M4RDV8 |
| Locus tag | FXZ37_RS00390 | Protein ID | WP_015449616.1 |
| Coordinates | 105394..105654 (-) | Length | 87 a.a. |
Antitoxin (Protein)
| Gene name | Axe | Uniprot ID | M4RA88 |
| Locus tag | FXZ37_RS00395 | Protein ID | WP_015449617.1 |
| Coordinates | 105658..105918 (-) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FXZ37_RS00370 | 100741..101715 | + | 975 | WP_015449610.1 | zinc metalloprotease HtpX | - |
| FXZ37_RS00375 | 101965..102810 | + | 846 | WP_015449612.1 | phosphatase PAP2 family protein | - |
| FXZ37_RS00380 | 102922..103332 | + | 411 | WP_015449613.1 | peptide deformylase | - |
| FXZ37_RS00385 | 103724..104905 | - | 1182 | WP_015449614.1 | aromatic amino acid DMT transporter YddG | - |
| FXZ37_RS08755 | 105179..105337 | - | 159 | WP_015449615.1 | hypothetical protein | - |
| FXZ37_RS00390 | 105394..105654 | - | 261 | WP_015449616.1 | Txe/YoeB family addiction module toxin | Toxin |
| FXZ37_RS00395 | 105658..105918 | - | 261 | WP_015449617.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| FXZ37_RS00405 | 106371..106538 | - | 168 | WP_026650596.1 | 50S ribosomal protein L32 | - |
| FXZ37_RS00410 | 106538..106660 | - | 123 | WP_015449619.1 | type B 50S ribosomal protein L36 | - |
| FXZ37_RS00415 | 106657..107031 | - | 375 | WP_015449620.1 | type B 50S ribosomal protein L31 | - |
| FXZ37_RS00420 | 107130..107435 | - | 306 | WP_015449621.1 | 30S ribosomal protein S14 | - |
| FXZ37_RS00425 | 107437..107604 | - | 168 | WP_015449622.1 | 50S ribosomal protein L33 | - |
| FXZ37_RS00430 | 107691..107930 | - | 240 | WP_026650597.1 | 50S ribosomal protein L28 | - |
| FXZ37_RS00435 | 107990..108853 | + | 864 | WP_015449624.1 | hypothetical protein | - |
| FXZ37_RS00440 | 109289..110062 | - | 774 | WP_015449625.1 | SDR family NAD(P)-dependent oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 87 a.a. Molecular weight: 10213.57 Da Isoelectric Point: 7.9936
>T288698 WP_015449616.1 NZ_LR698979:c105654-105394 [Bifidobacterium thermophilum]
MLRWTDDAWEDYLYWQSPDKRTLKRINALIRDAQRSPFEGIGKPEPLKWDFQGAWSRRIDSANRLIYMVADGDLCILSAR
DHYPGR
MLRWTDDAWEDYLYWQSPDKRTLKRINALIRDAQRSPFEGIGKPEPLKWDFQGAWSRRIDSANRLIYMVADGDLCILSAR
DHYPGR
Download Length: 261 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|