Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
Location | 2892012..2892651 | Replicon | chromosome |
Accession | NZ_LR698965 | ||
Organism | Planococcus massiliensis isolate MGYG-HGUT-01482 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | A0A098ENU8 |
Locus tag | FXZ10_RS14505 | Protein ID | WP_052653123.1 |
Coordinates | 2892012..2892362 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | - |
Locus tag | FXZ10_RS14510 | Protein ID | WP_110925660.1 |
Coordinates | 2892367..2892651 (-) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FXZ10_RS14470 | 2887555..2888337 | - | 783 | WP_052653111.1 | RNA polymerase sigma factor SigB | - |
FXZ10_RS14475 | 2888315..2888785 | - | 471 | WP_052653113.1 | anti-sigma B factor RsbW | - |
FXZ10_RS14480 | 2888787..2889116 | - | 330 | WP_052653115.1 | anti-sigma factor antagonist | - |
FXZ10_RS14485 | 2889210..2890211 | - | 1002 | WP_052653117.1 | PP2C family protein-serine/threonine phosphatase | - |
FXZ10_RS14490 | 2890224..2890625 | - | 402 | WP_052653119.1 | anti-sigma regulatory factor | - |
FXZ10_RS14495 | 2890628..2890990 | - | 363 | WP_036807366.1 | STAS domain-containing protein | - |
FXZ10_RS14500 | 2890987..2891817 | - | 831 | WP_052653121.1 | STAS domain-containing protein | - |
FXZ10_RS14505 | 2892012..2892362 | - | 351 | WP_052653123.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
FXZ10_RS14510 | 2892367..2892651 | - | 285 | WP_110925660.1 | transcriptional regulator | Antitoxin |
FXZ10_RS14515 | 2892749..2893849 | - | 1101 | WP_052653127.1 | alanine racemase | - |
FXZ10_RS14520 | 2893868..2894218 | - | 351 | WP_052653129.1 | holo-ACP synthase | - |
FXZ10_RS14525 | 2894285..2894893 | + | 609 | WP_052653131.1 | rhomboid family intramembrane serine protease | - |
FXZ10_RS14530 | 2894896..2896455 | - | 1560 | WP_052654653.1 | PH domain-containing protein | - |
FXZ10_RS14535 | 2896448..2896927 | - | 480 | WP_052653133.1 | PH domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12895.00 Da Isoelectric Point: 5.8882
>T288696 WP_052653123.1 NZ_LR698965:c2892362-2892012 [Planococcus massiliensis]
MIVKRGDVFFAELSPVVGSEQGGTRPVLVIQNDIGNRFSPTVIIAAITAQIQKAKLPTHVEINAKKYGFERDSVILLEQL
RTIDKSRLTDKITQLDETLMEKVDEALEISVGLVKF
MIVKRGDVFFAELSPVVGSEQGGTRPVLVIQNDIGNRFSPTVIIAAITAQIQKAKLPTHVEINAKKYGFERDSVILLEQL
RTIDKSRLTDKITQLDETLMEKVDEALEISVGLVKF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|