Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 284588..285201 | Replicon | chromosome |
Accession | NZ_LR698961 | ||
Organism | Helicobacter cinaedi isolate MGYG-HGUT-01432 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | I7GSY6 |
Locus tag | FXY34_RS01445 | Protein ID | WP_002957230.1 |
Coordinates | 284588..284989 (-) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | I7HE84 |
Locus tag | FXY34_RS01450 | Protein ID | WP_002957229.1 |
Coordinates | 284977..285201 (-) | Length | 75 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FXY34_RS01420 | 281513..283204 | - | 1692 | WP_002957237.1 | DUF262 domain-containing HNH endonuclease family protein | - |
FXY34_RS01425 | 283398..283604 | - | 207 | WP_002957235.1 | hypothetical protein | - |
FXY34_RS01430 | 283520..283717 | - | 198 | WP_002957234.1 | hypothetical protein | - |
FXY34_RS01435 | 283752..283940 | - | 189 | WP_014666336.1 | hypothetical protein | - |
FXY34_RS01440 | 284015..284386 | - | 372 | WP_002957232.1 | hypothetical protein | - |
FXY34_RS01445 | 284588..284989 | - | 402 | WP_002957230.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
FXY34_RS01450 | 284977..285201 | - | 225 | WP_002957229.1 | hypothetical protein | Antitoxin |
FXY34_RS01455 | 285337..286273 | + | 937 | Protein_283 | WYL domain-containing protein | - |
FXY34_RS01460 | 286416..287090 | + | 675 | WP_002957227.1 | hypothetical protein | - |
FXY34_RS01465 | 287139..288512 | + | 1374 | WP_015453250.1 | U32 family peptidase | - |
FXY34_RS01470 | 288516..289415 | - | 900 | WP_002957225.1 | ATP-binding cassette domain-containing protein | - |
FXY34_RS01475 | 289412..290089 | - | 678 | WP_172618402.1 | molybdate ABC transporter permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 15266.77 Da Isoelectric Point: 7.9901
>T288693 WP_002957230.1 NZ_LR698961:c284989-284588 [Helicobacter cinaedi]
MAKIMLDTNICIYIINNKPQYIKDRFLQYRIGDIAISSISVAELYFGVEKSQYKEANTNALNTFLTHLEVIDFAHKEALT
YAKIRADLEYKKSLIGAMDMLISAVALANDLTLITNNTKEFQRVKNLKIENWV
MAKIMLDTNICIYIINNKPQYIKDRFLQYRIGDIAISSISVAELYFGVEKSQYKEANTNALNTFLTHLEVIDFAHKEALT
YAKIRADLEYKKSLIGAMDMLISAVALANDLTLITNNTKEFQRVKNLKIENWV
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | I7GSY6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A809NJV2 |