Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PemK-RelB |
Location | 1831993..1832548 | Replicon | chromosome |
Accession | NZ_LR698953 | ||
Organism | Bifidobacterium longum isolate MGYG-HGUT-01292 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | B7GSS5 |
Locus tag | FXZ20_RS09200 | Protein ID | WP_003833460.1 |
Coordinates | 1832225..1832548 (+) | Length | 108 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S2ZDC4 |
Locus tag | FXZ20_RS09195 | Protein ID | WP_003829112.1 |
Coordinates | 1831993..1832238 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FXZ20_RS09175 | 1827820..1828482 | + | 663 | WP_012577980.1 | TetR/AcrR family transcriptional regulator | - |
FXZ20_RS09180 | 1828639..1829910 | + | 1272 | WP_012577981.1 | MFS transporter | - |
FXZ20_RS09185 | 1830094..1830298 | - | 205 | Protein_1714 | XRE family transcriptional regulator | - |
FXZ20_RS09190 | 1830563..1831819 | - | 1257 | WP_003829116.1 | HipA domain-containing protein | - |
FXZ20_RS09195 | 1831993..1832238 | + | 246 | WP_003829112.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
FXZ20_RS09200 | 1832225..1832548 | + | 324 | WP_003833460.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
FXZ20_RS09205 | 1832765..1833379 | - | 615 | WP_012577983.1 | cupin domain-containing protein | - |
FXZ20_RS09210 | 1833473..1834342 | - | 870 | WP_003829104.1 | class I SAM-dependent methyltransferase | - |
FXZ20_RS09215 | 1834580..1834945 | + | 366 | WP_012577984.1 | YccF domain-containing protein | - |
FXZ20_RS09225 | 1835475..1836740 | + | 1266 | WP_012577985.1 | Fic family protein | - |
FXZ20_RS09235 | 1837210..1837508 | + | 299 | Protein_1722 | IS256 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 11829.64 Da Isoelectric Point: 6.2932
>T288688 WP_003833460.1 NZ_LR698953:1832225-1832548 [Bifidobacterium longum]
MKRGEIRTLQADGYASKPRPVVIVQSDAVDRFDSVITCLLTSYDSSDIDTRVRLEPSPENGLNKVSYVMTDKIVTVDRKL
LGYQVGVVDDAAMANIGRQLMRVLGLL
MKRGEIRTLQADGYASKPRPVVIVQSDAVDRFDSVITCLLTSYDSSDIDTRVRLEPSPENGLNKVSYVMTDKIVTVDRKL
LGYQVGVVDDAAMANIGRQLMRVLGLL
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4R0SL31 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A087B6Q6 |