Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/RelB(antitoxin) |
Location | 1759537..1760173 | Replicon | chromosome |
Accession | NZ_LR698953 | ||
Organism | Bifidobacterium longum isolate MGYG-HGUT-01292 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | W6EZW1 |
Locus tag | FXZ20_RS08810 | Protein ID | WP_014484977.1 |
Coordinates | 1759817..1760173 (+) | Length | 119 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | D6PAX1 |
Locus tag | FXZ20_RS08805 | Protein ID | WP_012577921.1 |
Coordinates | 1759537..1759830 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FXZ20_RS08780 | 1754609..1755064 | - | 456 | WP_012577916.1 | Holliday junction resolvase RuvX | - |
FXZ20_RS08785 | 1755073..1757751 | - | 2679 | WP_012577917.1 | alanine--tRNA ligase | - |
FXZ20_RS13810 | 1757880..1758116 | - | 237 | WP_012577918.1 | hypothetical protein | - |
FXZ20_RS08795 | 1758116..1758514 | - | 399 | WP_012577919.1 | DUF948 domain-containing protein | - |
FXZ20_RS08800 | 1758597..1759280 | - | 684 | WP_012577920.1 | histidine phosphatase family protein | - |
FXZ20_RS08805 | 1759537..1759830 | + | 294 | WP_012577921.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
FXZ20_RS08810 | 1759817..1760173 | + | 357 | WP_014484977.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
FXZ20_RS08815 | 1760350..1760952 | - | 603 | WP_012577923.1 | transglutaminase family protein | - |
FXZ20_RS08820 | 1761057..1761413 | - | 357 | WP_012577924.1 | SdpI family protein | - |
FXZ20_RS08825 | 1761506..1761946 | + | 441 | WP_012577925.1 | cytidine deaminase | - |
FXZ20_RS08830 | 1762129..1762911 | + | 783 | WP_012577926.1 | gamma-glutamyl-gamma-aminobutyrate hydrolase family protein | - |
FXZ20_RS08835 | 1763090..1763716 | - | 627 | WP_007052130.1 | 30S ribosomal protein S4 | - |
FXZ20_RS08840 | 1763915..1764907 | - | 993 | WP_012577927.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 13302.25 Da Isoelectric Point: 8.9603
>T288687 WP_014484977.1 NZ_LR698953:1759817-1760173 [Bifidobacterium longum]
MMKTDPRQFEIWWVPFAFPDKPGKAKNRPSVILQWDDGTRIALVTKVTGNTWRDEPGYVVLRDWQDAGLSKPSAVRCSQL
LRLPSNLFLDDGPTGRLSAYDAGRVAWAINELYPGLLA
MMKTDPRQFEIWWVPFAFPDKPGKAKNRPSVILQWDDGTRIALVTKVTGNTWRDEPGYVVLRDWQDAGLSKPSAVRCSQL
LRLPSNLFLDDGPTGRLSAYDAGRVAWAINELYPGLLA
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0L7D489 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1S2VTZ6 |