Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-DinJ |
Location | 15155..15720 | Replicon | chromosome |
Accession | NZ_LR698953 | ||
Organism | Bifidobacterium longum isolate MGYG-HGUT-01292 |
Toxin (Protein)
Gene name | relE | Uniprot ID | B7GSH0 |
Locus tag | FXZ20_RS00065 | Protein ID | WP_012576472.1 |
Coordinates | 15155..15445 (-) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | B7GSH1 |
Locus tag | FXZ20_RS00070 | Protein ID | WP_012576473.1 |
Coordinates | 15442..15720 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FXZ20_RS00040 | 10364..10930 | + | 567 | WP_012576468.1 | DUF3566 domain-containing protein | - |
FXZ20_RS00050 | 11576..12997 | + | 1422 | WP_012576469.1 | ATP-binding protein | - |
FXZ20_RS00055 | 13058..13282 | - | 225 | WP_012576470.1 | hypothetical protein | - |
FXZ20_RS00060 | 13433..14779 | - | 1347 | WP_012576471.1 | NADP-specific glutamate dehydrogenase | - |
FXZ20_RS00065 | 15155..15445 | - | 291 | WP_012576472.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
FXZ20_RS00070 | 15442..15720 | - | 279 | WP_012576473.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
FXZ20_RS00075 | 16143..16547 | + | 405 | WP_126386265.1 | hypothetical protein | - |
FXZ20_RS00080 | 16552..16947 | - | 396 | WP_014484455.1 | transposase | - |
FXZ20_RS00085 | 17287..17931 | + | 645 | WP_012576475.1 | hypothetical protein | - |
FXZ20_RS00090 | 18353..18544 | - | 192 | WP_126386268.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 10835.59 Da Isoelectric Point: 10.3137
>T288683 WP_012576472.1 NZ_LR698953:c15445-15155 [Bifidobacterium longum]
MSGIRYTVKTTSRFRKDFKLARRRGLDAGLFKQVVSILSEGGTLPDRYHDHALTGNMTGFRECYITPDLLLVYLIEKDVL
VLTLTRTGTHSGLFGK
MSGIRYTVKTTSRFRKDFKLARRRGLDAGLFKQVVSILSEGGTLPDRYHDHALTGNMTGFRECYITPDLLLVYLIEKDVL
VLTLTRTGTHSGLFGK
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | B7GSH0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0A8MHE5 |