Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ImmA-IrrE/Peptidase_M78-HTH_19 |
Location | 2408863..2409557 | Replicon | chromosome |
Accession | NZ_LR698844 | ||
Organism | Enterococcus faecalis isolate MGYG-HGUT-01694 |
Toxin (Protein)
Gene name | IrrE | Uniprot ID | A0A828QV40 |
Locus tag | FXY61_RS11915 | Protein ID | WP_002406159.1 |
Coordinates | 2409213..2409557 (+) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | ImmA | Uniprot ID | A0A828QTI6 |
Locus tag | FXY61_RS11910 | Protein ID | WP_002406160.1 |
Coordinates | 2408863..2409195 (+) | Length | 111 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FXY61_RS11870 | 2404367..2405155 | - | 789 | WP_002406165.1 | DnaD domain protein | - |
FXY61_RS11875 | 2405171..2405958 | - | 788 | Protein_2306 | PD-(D/E)XK nuclease-like domain-containing protein | - |
FXY61_RS11880 | 2405921..2406892 | - | 972 | WP_015212255.1 | recombinase RecT | - |
FXY61_RS11885 | 2406995..2407219 | - | 225 | WP_002370012.1 | hypothetical protein | - |
FXY61_RS11890 | 2407216..2407515 | - | 300 | WP_002406162.1 | hypothetical protein | - |
FXY61_RS11895 | 2407602..2408018 | - | 417 | WP_002370016.1 | hypothetical protein | - |
FXY61_RS11900 | 2408212..2408355 | - | 144 | WP_002393055.1 | hypothetical protein | - |
FXY61_RS11905 | 2408366..2408542 | - | 177 | WP_002364354.1 | helix-turn-helix transcriptional regulator | - |
FXY61_RS11910 | 2408863..2409195 | + | 333 | WP_002406160.1 | helix-turn-helix domain-containing protein | Antitoxin |
FXY61_RS11915 | 2409213..2409557 | + | 345 | WP_002406159.1 | ImmA/IrrE family metallo-endopeptidase | Toxin |
FXY61_RS11920 | 2409627..2410076 | + | 450 | WP_002406158.1 | hypothetical protein | - |
FXY61_RS11925 | 2410186..2411553 | + | 1368 | WP_002406157.1 | recombinase family protein | - |
FXY61_RS11930 | 2411575..2412150 | - | 576 | WP_002393061.1 | DNA repair protein RadC | - |
FXY61_RS11935 | 2412182..2412841 | - | 660 | WP_002398690.1 | HAD family hydrolase | - |
FXY61_RS11940 | 2412825..2414147 | - | 1323 | WP_002410879.1 | bifunctional folylpolyglutamate synthase/dihydrofolate synthase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2368853..2412126 | 43273 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13556.36 Da Isoelectric Point: 4.9882
>T288665 WP_002406159.1 NZ_LR698844:2409213-2409557 [Enterococcus faecalis]
MKSIKELVEEYNVELVFTTLHKKACFESEHGVIFVNQNLSTEEQEEAIYHEFKHVKDHADLMALYNIPIFRSKMEAEAEH
YMFECLIEKNDGQFNYSNVITHYNLKMGQETYLK
MKSIKELVEEYNVELVFTTLHKKACFESEHGVIFVNQNLSTEEQEEAIYHEFKHVKDHADLMALYNIPIFRSKMEAEAEH
YMFECLIEKNDGQFNYSNVITHYNLKMGQETYLK
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A828QV40 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A828QTI6 |