Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
| Location | 383800..384730 | Replicon | chromosome |
| Accession | NZ_LR698844 | ||
| Organism | Enterococcus faecalis isolate MGYG-HGUT-01694 | ||
Toxin (Protein)
| Gene name | zeta | Uniprot ID | - |
| Locus tag | FXY61_RS01920 | Protein ID | WP_002389521.1 |
| Coordinates | 383800..384456 (-) | Length | 219 a.a. |
Antitoxin (Protein)
| Gene name | epsilon | Uniprot ID | R2XCR7 |
| Locus tag | FXY61_RS01925 | Protein ID | WP_000301765.1 |
| Coordinates | 384458..384730 (-) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FXY61_RS01895 | 378890..379120 | - | 231 | WP_002355366.1 | helix-turn-helix domain-containing protein | - |
| FXY61_RS01905 | 379976..380221 | - | 246 | WP_002358448.1 | helix-turn-helix domain-containing protein | - |
| FXY61_RS01910 | 380215..380616 | - | 402 | WP_002364925.1 | sigma-70 family RNA polymerase sigma factor | - |
| FXY61_RS01920 | 383800..384456 | - | 657 | WP_002389521.1 | zeta toxin family protein | Toxin |
| FXY61_RS01925 | 384458..384730 | - | 273 | WP_000301765.1 | antitoxin | Antitoxin |
| FXY61_RS01930 | 384747..384956 | - | 210 | WP_002389526.1 | peptide-binding protein | - |
| FXY61_RS01935 | 385026..385922 | - | 897 | WP_096001398.1 | ParA family protein | - |
| FXY61_RS01940 | 385997..386119 | - | 123 | Protein_358 | topoisomerase | - |
| FXY61_RS01945 | 386311..387594 | - | 1284 | WP_002363033.1 | PTS sugar transporter subunit IIC | - |
| FXY61_RS01950 | 387611..388537 | - | 927 | WP_002389507.1 | hypothetical protein | - |
| FXY61_RS01955 | 388714..389442 | + | 729 | WP_002389508.1 | GntR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | ClpL | EF0485 / bsh | 379266..479894 | 100628 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 219 a.a. Molecular weight: 24481.80 Da Isoelectric Point: 6.1232
>T288664 WP_002389521.1 NZ_LR698844:c384456-383800 [Enterococcus faecalis]
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEAIISRLSDKGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLLSDIRLYNREGVKLYSSLETG
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEAIISRLSDKGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLLSDIRLYNREGVKLYSSLETG
Download Length: 657 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 3Q8X | |
| PDB | 1GVN | |
| AlphaFold DB | A0A829F0A3 |