Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 141753..142258 | Replicon | chromosome |
Accession | NZ_LR657304 | ||
Organism | Pseudomonas aeruginosa PAK |
Toxin (Protein)
Gene name | parE | Uniprot ID | V6A7K8 |
Locus tag | PAKAF_RS00645 | Protein ID | WP_003083773.1 |
Coordinates | 141753..142034 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q9I707 |
Locus tag | PAKAF_RS00650 | Protein ID | WP_003112628.1 |
Coordinates | 142031..142258 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PAKAF_RS00620 | 137004..138353 | + | 1350 | WP_003142411.1 | C4-dicarboxylate transporter DctA | - |
PAKAF_RS00625 | 138402..139088 | + | 687 | WP_004351997.1 | FadR family transcriptional regulator | - |
PAKAF_RS00630 | 139189..139923 | + | 735 | WP_003117208.1 | GntR family transcriptional regulator | - |
PAKAF_RS00635 | 140127..140513 | + | 387 | WP_014602345.1 | aegerolysin family protein | - |
PAKAF_RS00640 | 140545..141453 | - | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
PAKAF_RS00645 | 141753..142034 | - | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
PAKAF_RS00650 | 142031..142258 | - | 228 | WP_003112628.1 | CopG family ribbon-helix-helix protein | Antitoxin |
PAKAF_RS00655 | 142434..143054 | - | 621 | WP_016252837.1 | hypothetical protein | - |
PAKAF_RS00660 | 143155..143655 | + | 501 | WP_003101228.1 | LEA type 2 family protein | - |
PAKAF_RS00665 | 143728..144069 | + | 342 | WP_003101229.1 | alkylphosphonate utilization protein | - |
PAKAF_RS00670 | 144151..145578 | - | 1428 | WP_016252838.1 | GABA permease | - |
PAKAF_RS00675 | 145747..147240 | - | 1494 | WP_003083788.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T288657 WP_003083773.1 NZ_LR657304:c142034-141753 [Pseudomonas aeruginosa PAK]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|