Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/RelB(antitoxin) |
Location | 1329287..1329923 | Replicon | chromosome |
Accession | NZ_LR655210 | ||
Organism | Bifidobacterium longum subsp. infantis isolate B.longum_ssp_infantis_6 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | W6EZW1 |
Locus tag | BILO16373828_RS06000 | Protein ID | WP_014484977.1 |
Coordinates | 1329287..1329643 (-) | Length | 119 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | D6PAX1 |
Locus tag | BILO16373828_RS06005 | Protein ID | WP_012577921.1 |
Coordinates | 1329630..1329923 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BILO16373828_RS05970 | 1324553..1325545 | + | 993 | WP_012577927.1 | ABC transporter ATP-binding protein | - |
BILO16373828_RS05975 | 1325744..1326370 | + | 627 | WP_007052130.1 | 30S ribosomal protein S4 | - |
BILO16373828_RS05980 | 1326549..1327331 | - | 783 | WP_012577926.1 | gamma-glutamyl-gamma-aminobutyrate hydrolase family protein | - |
BILO16373828_RS05985 | 1327514..1327954 | - | 441 | WP_012577925.1 | cytidine deaminase | - |
BILO16373828_RS05990 | 1328047..1328403 | + | 357 | WP_012577924.1 | SdpI family protein | - |
BILO16373828_RS05995 | 1328508..1329110 | + | 603 | WP_012577923.1 | transglutaminase family protein | - |
BILO16373828_RS06000 | 1329287..1329643 | - | 357 | WP_014484977.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
BILO16373828_RS06005 | 1329630..1329923 | - | 294 | WP_012577921.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
BILO16373828_RS06010 | 1330180..1330863 | + | 684 | WP_012577920.1 | histidine phosphatase family protein | - |
BILO16373828_RS06015 | 1330946..1331344 | + | 399 | WP_012577919.1 | DUF948 domain-containing protein | - |
BILO16373828_RS13725 | 1331344..1331580 | + | 237 | WP_012577918.1 | hypothetical protein | - |
BILO16373828_RS06025 | 1331709..1334387 | + | 2679 | WP_012577917.1 | alanine--tRNA ligase | - |
BILO16373828_RS06030 | 1334396..1334851 | + | 456 | WP_012577916.1 | Holliday junction resolvase RuvX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 13302.25 Da Isoelectric Point: 8.9603
>T288653 WP_014484977.1 NZ_LR655210:c1329643-1329287 [Bifidobacterium longum subsp. infantis]
MMKTDPRQFEIWWVPFAFPDKPGKAKNRPSVILQWDDGTRIALVTKVTGNTWRDEPGYVVLRDWQDAGLSKPSAVRCSQL
LRLPSNLFLDDGPTGRLSAYDAGRVAWAINELYPGLLA
MMKTDPRQFEIWWVPFAFPDKPGKAKNRPSVILQWDDGTRIALVTKVTGNTWRDEPGYVVLRDWQDAGLSKPSAVRCSQL
LRLPSNLFLDDGPTGRLSAYDAGRVAWAINELYPGLLA
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0L7D489 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1S2VTZ6 |