Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PemK-RelB |
Location | 1256912..1257467 | Replicon | chromosome |
Accession | NZ_LR655210 | ||
Organism | Bifidobacterium longum subsp. infantis isolate B.longum_ssp_infantis_6 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | B7GSS5 |
Locus tag | BILO16373828_RS05610 | Protein ID | WP_003833460.1 |
Coordinates | 1256912..1257235 (-) | Length | 108 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S2ZDC4 |
Locus tag | BILO16373828_RS05615 | Protein ID | WP_003829112.1 |
Coordinates | 1257222..1257467 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BILO16373828_RS05575 | 1251952..1252250 | - | 299 | Protein_1029 | IS256 family transposase | - |
BILO16373828_RS05585 | 1252720..1253985 | - | 1266 | WP_012577985.1 | Fic family protein | - |
BILO16373828_RS05595 | 1254515..1254880 | - | 366 | WP_012577984.1 | YccF domain-containing protein | - |
BILO16373828_RS05600 | 1255118..1255987 | + | 870 | WP_003829104.1 | class I SAM-dependent methyltransferase | - |
BILO16373828_RS05605 | 1256081..1256695 | + | 615 | WP_012577983.1 | cupin domain-containing protein | - |
BILO16373828_RS05610 | 1256912..1257235 | - | 324 | WP_003833460.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
BILO16373828_RS05615 | 1257222..1257467 | - | 246 | WP_003829112.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
BILO16373828_RS05620 | 1257641..1258897 | + | 1257 | WP_003829116.1 | HipA domain-containing protein | - |
BILO16373828_RS05625 | 1259162..1259366 | + | 205 | Protein_1037 | XRE family transcriptional regulator | - |
BILO16373828_RS05630 | 1259550..1260821 | - | 1272 | WP_012577981.1 | MFS transporter | - |
BILO16373828_RS05635 | 1260978..1261640 | - | 663 | WP_012577980.1 | TetR/AcrR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 11829.64 Da Isoelectric Point: 6.2932
>T288652 WP_003833460.1 NZ_LR655210:c1257235-1256912 [Bifidobacterium longum subsp. infantis]
MKRGEIRTLQADGYASKPRPVVIVQSDAVDRFDSVITCLLTSYDSSDIDTRVRLEPSPENGLNKVSYVMTDKIVTVDRKL
LGYQVGVVDDAAMANIGRQLMRVLGLL
MKRGEIRTLQADGYASKPRPVVIVQSDAVDRFDSVITCLLTSYDSSDIDTRVRLEPSPENGLNKVSYVMTDKIVTVDRKL
LGYQVGVVDDAAMANIGRQLMRVLGLL
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4R0SL31 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A087B6Q6 |