Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-DinJ |
Location | 240945..241510 | Replicon | chromosome |
Accession | NZ_LR655210 | ||
Organism | Bifidobacterium longum subsp. infantis isolate B.longum_ssp_infantis_6 |
Toxin (Protein)
Gene name | relE | Uniprot ID | B7GSH0 |
Locus tag | BILO16373828_RS01105 | Protein ID | WP_012576472.1 |
Coordinates | 241220..241510 (+) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | B7GSH1 |
Locus tag | BILO16373828_RS01100 | Protein ID | WP_012576473.1 |
Coordinates | 240945..241223 (+) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BILO16373828_RS01080 | 238121..238312 | + | 192 | WP_126386268.1 | hypothetical protein | - |
BILO16373828_RS01085 | 238734..239378 | - | 645 | WP_012576475.1 | hypothetical protein | - |
BILO16373828_RS01090 | 239718..240113 | + | 396 | WP_014484455.1 | transposase | - |
BILO16373828_RS01095 | 240118..240465 | - | 348 | WP_162010634.1 | hypothetical protein | - |
BILO16373828_RS01100 | 240945..241223 | + | 279 | WP_012576473.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
BILO16373828_RS01105 | 241220..241510 | + | 291 | WP_012576472.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
BILO16373828_RS01110 | 241886..243232 | + | 1347 | WP_012576471.1 | NADP-specific glutamate dehydrogenase | - |
BILO16373828_RS01115 | 243383..243607 | + | 225 | WP_012576470.1 | hypothetical protein | - |
BILO16373828_RS01120 | 243668..245089 | - | 1422 | WP_012576469.1 | ATP-binding protein | - |
BILO16373828_RS01130 | 245735..246301 | - | 567 | WP_012576468.1 | DUF3566 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 230300..245089 | 14789 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 10835.59 Da Isoelectric Point: 10.3137
>T288651 WP_012576472.1 NZ_LR655210:241220-241510 [Bifidobacterium longum subsp. infantis]
MSGIRYTVKTTSRFRKDFKLARRRGLDAGLFKQVVSILSEGGTLPDRYHDHALTGNMTGFRECYITPDLLLVYLIEKDVL
VLTLTRTGTHSGLFGK
MSGIRYTVKTTSRFRKDFKLARRRGLDAGLFKQVVSILSEGGTLPDRYHDHALTGNMTGFRECYITPDLLLVYLIEKDVL
VLTLTRTGTHSGLFGK
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | B7GSH0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0A8MHE5 |