Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/YafQ-RelB |
| Location | 1244999..1245565 | Replicon | chromosome |
| Accession | NZ_LR655209 | ||
| Organism | Bifidobacterium breve isolate B.breve_1_mod | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | BWLFYP14_RS05615 | Protein ID | WP_144181702.1 |
| Coordinates | 1245272..1245565 (+) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | BWLFYP14_RS05610 | Protein ID | WP_101674005.1 |
| Coordinates | 1244999..1245268 (+) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BWLFYP14_RS05580 | 1240955..1241968 | - | 1014 | WP_172618571.1 | VanZ family protein | - |
| BWLFYP14_RS05585 | 1242115..1242940 | + | 826 | Protein_1032 | aminotransferase class V-fold PLP-dependent enzyme | - |
| BWLFYP14_RS05590 | 1243126..1243260 | + | 135 | WP_101674002.1 | DUF2316 family protein | - |
| BWLFYP14_RS05595 | 1243301..1243834 | - | 534 | WP_101674003.1 | GNAT family N-acetyltransferase | - |
| BWLFYP14_RS05600 | 1244189..1244308 | + | 120 | WP_171843146.1 | IS3 family transposase | - |
| BWLFYP14_RS05605 | 1244317..1244814 | + | 498 | Protein_1036 | FtsX-like permease family protein | - |
| BWLFYP14_RS05610 | 1244999..1245268 | + | 270 | WP_101674005.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| BWLFYP14_RS05615 | 1245272..1245565 | + | 294 | WP_144181702.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| BWLFYP14_RS05620 | 1245776..1245972 | + | 197 | Protein_1039 | permease | - |
| BWLFYP14_RS05625 | 1246296..1247876 | + | 1581 | WP_144181703.1 | amino acid permease | - |
| BWLFYP14_RS05630 | 1248118..1248357 | - | 240 | WP_014483708.1 | hypothetical protein | - |
| BWLFYP14_RS05635 | 1248655..1249008 | + | 354 | WP_014483707.1 | DUF488 domain-containing protein | - |
| BWLFYP14_RS10605 | 1249074..1249502 | - | 429 | WP_065470715.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11190.93 Da Isoelectric Point: 9.7881
>T288650 WP_144181702.1 NZ_LR655209:1245272-1245565 [Bifidobacterium breve]
MLKPDYTAAFQRDIKKLKRKHADLRPLKEVIRLVLEDTADSKEALRRRHRTHTLTGDLNGVLECHIGNAGDWLLLWIRDD
GTAMFMRTGSHDELLGK
MLKPDYTAAFQRDIKKLKRKHADLRPLKEVIRLVLEDTADSKEALRRRHRTHTLTGDLNGVLECHIGNAGDWLLLWIRDD
GTAMFMRTGSHDELLGK
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|