Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/RelB(antitoxin) |
Location | 1072823..1073459 | Replicon | chromosome |
Accession | NZ_LR655209 | ||
Organism | Bifidobacterium breve isolate B.breve_1_mod |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | BWLFYP14_RS04775 | Protein ID | WP_144180608.1 |
Coordinates | 1072823..1073179 (-) | Length | 119 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A2K9C8D0 |
Locus tag | BWLFYP14_RS04780 | Protein ID | WP_025221547.1 |
Coordinates | 1073166..1073459 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BWLFYP14_RS04745 | 1068023..1068934 | + | 912 | WP_144180601.1 | ABC transporter ATP-binding protein | - |
BWLFYP14_RS04750 | 1069131..1069757 | + | 627 | WP_003829226.1 | 30S ribosomal protein S4 | - |
BWLFYP14_RS04755 | 1070095..1070877 | - | 783 | WP_115767668.1 | gamma-glutamyl-gamma-aminobutyrate hydrolase family protein | - |
BWLFYP14_RS04760 | 1071015..1071500 | - | 486 | WP_014483808.1 | cytidine deaminase | - |
BWLFYP14_RS04765 | 1071590..1071946 | + | 357 | WP_144180603.1 | SdpI family protein | - |
BWLFYP14_RS04770 | 1072051..1072653 | + | 603 | WP_144180606.1 | transglutaminase family protein | - |
BWLFYP14_RS04775 | 1072823..1073179 | - | 357 | WP_144180608.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
BWLFYP14_RS04780 | 1073166..1073459 | - | 294 | WP_025221547.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
BWLFYP14_RS04785 | 1073710..1074384 | + | 675 | WP_065456637.1 | histidine phosphatase family protein | - |
BWLFYP14_RS04790 | 1074467..1074850 | + | 384 | WP_016463075.1 | DUF948 domain-containing protein | - |
BWLFYP14_RS04795 | 1074850..1075086 | + | 237 | WP_003829239.1 | hypothetical protein | - |
BWLFYP14_RS04800 | 1075182..1077860 | + | 2679 | WP_106621641.1 | alanine--tRNA ligase | - |
BWLFYP14_RS04805 | 1077869..1078321 | + | 453 | WP_003829241.1 | Holliday junction resolvase RuvX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 13345.28 Da Isoelectric Point: 9.5964
>T288649 WP_144180608.1 NZ_LR655209:c1073179-1072823 [Bifidobacterium breve]
MMKTDPRQFEIWWVPFAFPDKPGKAKNRPSVILQWDDGTRIALVTKVTGNTWRDEPGYVVLRDWQDAGLSKPSAVRCSQL
LRLPSNLFRDDGPTGRLSAYDAGRVAWAINELYPGLLA
MMKTDPRQFEIWWVPFAFPDKPGKAKNRPSVILQWDDGTRIALVTKVTGNTWRDEPGYVVLRDWQDAGLSKPSAVRCSQL
LRLPSNLFRDDGPTGRLSAYDAGRVAWAINELYPGLLA
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|