Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/RelB(antitoxin) |
Location | 570646..571264 | Replicon | chromosome |
Accession | NZ_LR595857 | ||
Organism | Streptococcus sp. NCTC 11567 strain NCTC11567 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | FQT67_RS03055 | Protein ID | WP_003058081.1 |
Coordinates | 570646..570987 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | FQT67_RS03060 | Protein ID | WP_003058067.1 |
Coordinates | 570977..571264 (-) | Length | 96 a.a. |
Genomic Context
Location: 566109..567353 (1245 bp)
Type: Others
Protein ID: WP_014612120.1
Type: Others
Protein ID: WP_014612120.1
Location: 567364..567561 (198 bp)
Type: Others
Protein ID: WP_003058094.1
Type: Others
Protein ID: WP_003058094.1
Location: 567581..568684 (1104 bp)
Type: Others
Protein ID: WP_046177356.1
Type: Others
Protein ID: WP_046177356.1
Location: 568687..570588 (1902 bp)
Type: Others
Protein ID: WP_003058051.1
Type: Others
Protein ID: WP_003058051.1
Location: 570646..570987 (342 bp)
Type: Toxin
Protein ID: WP_003058081.1
Type: Toxin
Protein ID: WP_003058081.1
Location: 570977..571264 (288 bp)
Type: Antitoxin
Protein ID: WP_003058067.1
Type: Antitoxin
Protein ID: WP_003058067.1
Location: 571335..573833 (2499 bp)
Type: Others
Protein ID: WP_003058044.1
Type: Others
Protein ID: WP_003058044.1
Location: 573817..574233 (417 bp)
Type: Others
Protein ID: WP_003058056.1
Type: Others
Protein ID: WP_003058056.1
Location: 574242..574460 (219 bp)
Type: Others
Protein ID: WP_003058071.1
Type: Others
Protein ID: WP_003058071.1
Location: 574457..575398 (942 bp)
Type: Others
Protein ID: WP_003058075.1
Type: Others
Protein ID: WP_003058075.1
Location: 575411..575674 (264 bp)
Type: Others
Protein ID: WP_003058063.1
Type: Others
Protein ID: WP_003058063.1
Location: 575684..575956 (273 bp)
Type: Others
Protein ID: WP_046177355.1
Type: Others
Protein ID: WP_046177355.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FQT67_RS03035 | 566109..567353 | - | 1245 | WP_014612120.1 | site-specific integrase | - |
FQT67_RS03040 | 567364..567561 | - | 198 | WP_003058094.1 | transposase | - |
FQT67_RS03045 | 567581..568684 | - | 1104 | WP_046177356.1 | CHAP domain-containing protein | - |
FQT67_RS03050 | 568687..570588 | - | 1902 | WP_003058051.1 | hypothetical protein | - |
FQT67_RS03055 | 570646..570987 | - | 342 | WP_003058081.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
FQT67_RS03060 | 570977..571264 | - | 288 | WP_003058067.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
FQT67_RS03065 | 571335..573833 | - | 2499 | WP_003058044.1 | ATP-binding protein | - |
FQT67_RS03070 | 573817..574233 | - | 417 | WP_003058056.1 | conjugal transfer protein | - |
FQT67_RS03075 | 574242..574460 | - | 219 | WP_003058071.1 | hypothetical protein | - |
FQT67_RS03080 | 574457..575398 | - | 942 | WP_003058075.1 | conjugal transfer protein | - |
FQT67_RS03085 | 575411..575674 | - | 264 | WP_003058063.1 | hypothetical protein | - |
FQT67_RS03090 | 575684..575956 | - | 273 | WP_046177355.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 566109..593452 | 27343 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13438.41 Da Isoelectric Point: 7.0067
>T288639 WP_003058081.1 NZ_LR595857:c570987-570646 [Streptococcus sp. NCTC 11567]
MAYNVQITKSAERDLDSIYQFYLDEFSEQSALKVIKSLQDAISFLYVSPLGYTDFDSKINRKIYPQGNLRMIPSKQYLIF
YLIREERVDVLRIIHSRTDYLNNLENLFKNLNL
MAYNVQITKSAERDLDSIYQFYLDEFSEQSALKVIKSLQDAISFLYVSPLGYTDFDSKINRKIYPQGNLRMIPSKQYLIF
YLIREERVDVLRIIHSRTDYLNNLENLFKNLNL
Download Length: 342 bp