Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelB(antitoxin) |
Location | 570646..571264 | Replicon | chromosome |
Accession | NZ_LR595857 | ||
Organism | Streptococcus sp. NCTC 11567 strain NCTC11567 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | FQT67_RS03055 | Protein ID | WP_003058081.1 |
Coordinates | 570646..570987 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | FQT67_RS03060 | Protein ID | WP_003058067.1 |
Coordinates | 570977..571264 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FQT67_RS03035 | 566109..567353 | - | 1245 | WP_014612120.1 | site-specific integrase | - |
FQT67_RS03040 | 567364..567561 | - | 198 | WP_003058094.1 | transposase | - |
FQT67_RS03045 | 567581..568684 | - | 1104 | WP_046177356.1 | CHAP domain-containing protein | - |
FQT67_RS03050 | 568687..570588 | - | 1902 | WP_003058051.1 | hypothetical protein | - |
FQT67_RS03055 | 570646..570987 | - | 342 | WP_003058081.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
FQT67_RS03060 | 570977..571264 | - | 288 | WP_003058067.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
FQT67_RS03065 | 571335..573833 | - | 2499 | WP_003058044.1 | ATP-binding protein | - |
FQT67_RS03070 | 573817..574233 | - | 417 | WP_003058056.1 | conjugal transfer protein | - |
FQT67_RS03075 | 574242..574460 | - | 219 | WP_003058071.1 | hypothetical protein | - |
FQT67_RS03080 | 574457..575398 | - | 942 | WP_003058075.1 | conjugal transfer protein | - |
FQT67_RS03085 | 575411..575674 | - | 264 | WP_003058063.1 | hypothetical protein | - |
FQT67_RS03090 | 575684..575956 | - | 273 | WP_046177355.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 566109..593452 | 27343 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13438.41 Da Isoelectric Point: 7.0067
>T288639 WP_003058081.1 NZ_LR595857:c570987-570646 [Streptococcus sp. NCTC 11567]
MAYNVQITKSAERDLDSIYQFYLDEFSEQSALKVIKSLQDAISFLYVSPLGYTDFDSKINRKIYPQGNLRMIPSKQYLIF
YLIREERVDVLRIIHSRTDYLNNLENLFKNLNL
MAYNVQITKSAERDLDSIYQFYLDEFSEQSALKVIKSLQDAISFLYVSPLGYTDFDSKINRKIYPQGNLRMIPSKQYLIF
YLIREERVDVLRIIHSRTDYLNNLENLFKNLNL
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|