Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
Location | 278255..278867 | Replicon | chromosome |
Accession | NZ_LR595857 | ||
Organism | Streptococcus sp. NCTC 11567 strain NCTC11567 |
Toxin (Protein)
Gene name | parE | Uniprot ID | Q8E7D3 |
Locus tag | FQT67_RS01545 | Protein ID | WP_000384859.1 |
Coordinates | 278255..278590 (-) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q8E7D2 |
Locus tag | FQT67_RS01550 | Protein ID | WP_000259017.1 |
Coordinates | 278580..278867 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FQT67_RS01515 | 273454..274083 | + | 630 | WP_046177566.1 | hypothetical protein | - |
FQT67_RS01525 | 274395..275270 | + | 876 | WP_000421240.1 | hypothetical protein | - |
FQT67_RS01530 | 275306..275740 | + | 435 | WP_001220479.1 | hypothetical protein | - |
FQT67_RS01535 | 276056..277312 | + | 1257 | WP_143936361.1 | plasmid recombination protein | - |
FQT67_RS01540 | 277480..277950 | + | 471 | WP_000130119.1 | hypothetical protein | - |
FQT67_RS01545 | 278255..278590 | - | 336 | WP_000384859.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
FQT67_RS01550 | 278580..278867 | - | 288 | WP_000259017.1 | hypothetical protein | Antitoxin |
FQT67_RS01555 | 279269..279631 | - | 363 | WP_080554381.1 | tyrosine-type recombinase/integrase | - |
FQT67_RS01560 | 279742..281463 | + | 1722 | WP_046177550.1 | PTS sugar transporter subunit IIA | - |
FQT67_RS01565 | 281465..281923 | + | 459 | Protein_255 | PTS sugar transporter subunit IIA | - |
FQT67_RS01570 | 281933..283273 | + | 1341 | WP_046177549.1 | PTS galactitol transporter subunit IIC | - |
FQT67_RS01575 | 283270..283554 | + | 285 | WP_012766555.1 | PTS sugar transporter subunit IIB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 265788..281923 | 16135 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13296.98 Da Isoelectric Point: 4.6565
>T288638 WP_000384859.1 NZ_LR595857:c278590-278255 [Streptococcus sp. NCTC 11567]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIINDIEKLEVFPEVGFDADEKYGSEISNYHSTRGYTLSKD
YIVLYHIEEEENRVVIDYLLPTRSDYMKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIINDIEKLEVFPEVGFDADEKYGSEISNYHSTRGYTLSKD
YIVLYHIEEEENRVVIDYLLPTRSDYMKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|