Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 5010216..5010792 | Replicon | chromosome |
| Accession | NZ_LR595855 | ||
| Organism | Raoultella terrigena strain NCTC9189 | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | - |
| Locus tag | FQU09_RS24235 | Protein ID | WP_115193645.1 |
| Coordinates | 5010505..5010792 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | - |
| Locus tag | FQU09_RS24230 | Protein ID | WP_115193644.1 |
| Coordinates | 5010216..5010518 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FQU09_RS24205 | 5005302..5006366 | - | 1065 | WP_115193639.1 | DUF2955 domain-containing protein | - |
| FQU09_RS24210 | 5006356..5007423 | - | 1068 | WP_115193640.1 | HlyD family secretion protein | - |
| FQU09_RS24215 | 5007430..5007894 | - | 465 | WP_115193641.1 | MarR family transcriptional regulator | - |
| FQU09_RS24220 | 5008347..5008511 | - | 165 | WP_115193642.1 | DUF1127 domain-containing protein | - |
| FQU09_RS24225 | 5008689..5010101 | + | 1413 | WP_115193643.1 | PLP-dependent aminotransferase family protein | - |
| FQU09_RS24230 | 5010216..5010518 | - | 303 | WP_115193644.1 | BrnA antitoxin family protein | Antitoxin |
| FQU09_RS24235 | 5010505..5010792 | - | 288 | WP_115193645.1 | BrnT family toxin | Toxin |
| FQU09_RS24240 | 5010910..5011329 | - | 420 | WP_115193646.1 | FosA family fosfomycin resistance glutathione transferase | - |
| FQU09_RS24245 | 5011333..5012232 | - | 900 | WP_143967758.1 | LysR family transcriptional regulator | - |
| FQU09_RS24250 | 5012320..5013102 | + | 783 | WP_115193648.1 | NAD(P)H-dependent oxidoreductase | - |
| FQU09_RS24255 | 5013249..5013827 | + | 579 | WP_041143880.1 | TetR/AcrR family transcriptional regulator | - |
| FQU09_RS24260 | 5013872..5014687 | + | 816 | WP_143967759.1 | helix-turn-helix domain-containing protein | - |
| FQU09_RS24265 | 5014684..5015202 | + | 519 | WP_041143878.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10979.33 Da Isoelectric Point: 6.6066
>T288637 WP_115193645.1 NZ_LR595855:c5010792-5010505 [Raoultella terrigena]
MPMEFEWDANKAASNLSKHGIRFEEAVLVFDDPQHLSHQDRYENGEHRWQTIGLVHGIIVILVVHSVRFESGAEVIRIIS
ARKADGKERSRYEHS
MPMEFEWDANKAASNLSKHGIRFEEAVLVFDDPQHLSHQDRYENGEHRWQTIGLVHGIIVILVVHSVRFESGAEVIRIIS
ARKADGKERSRYEHS
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|