Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4422920..4423539 | Replicon | chromosome |
| Accession | NZ_LR595855 | ||
| Organism | Raoultella terrigena strain NCTC9189 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | A0A8B4Z516 |
| Locus tag | FQU09_RS21390 | Protein ID | WP_041144355.1 |
| Coordinates | 4423321..4423539 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | A0A8B4Z4D4 |
| Locus tag | FQU09_RS21385 | Protein ID | WP_041144356.1 |
| Coordinates | 4422920..4423294 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FQU09_RS21375 | 4418082..4419263 | + | 1182 | WP_143967626.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| FQU09_RS21380 | 4419298..4422444 | + | 3147 | WP_041144357.1 | multidrug efflux RND transporter permease subunit | - |
| FQU09_RS21385 | 4422920..4423294 | + | 375 | WP_041144356.1 | Hha toxicity modulator TomB | Antitoxin |
| FQU09_RS21390 | 4423321..4423539 | + | 219 | WP_041144355.1 | hemolysin expression modulator Hha | Toxin |
| FQU09_RS21395 | 4423689..4424255 | + | 567 | WP_041144354.1 | maltose O-acetyltransferase | - |
| FQU09_RS21400 | 4424354..4424821 | + | 468 | WP_041144353.1 | YlaC family protein | - |
| FQU09_RS21405 | 4424793..4426250 | - | 1458 | WP_143967627.1 | PLP-dependent aminotransferase family protein | - |
| FQU09_RS21410 | 4426352..4427062 | + | 711 | WP_143967628.1 | GNAT family N-acetyltransferase | - |
| FQU09_RS21415 | 4427059..4427199 | - | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
| FQU09_RS21420 | 4427202..4427462 | - | 261 | WP_041144350.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8580.94 Da Isoelectric Point: 7.9907
>T288636 WP_041144355.1 NZ_LR595855:4423321-4423539 [Raoultella terrigena]
MSGEPLTKTDYLMRLRRCQTIDTLERVIEKNKYELPDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSGEPLTKTDYLMRLRRCQTIDTLERVIEKNKYELPDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14397.16 Da Isoelectric Point: 4.8886
>AT288636 WP_041144356.1 NZ_LR595855:4422920-4423294 [Raoultella terrigena]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIDHIATFALNYKIKYAEDNKLIAQLDEYL
DDTFMLFSSYGINSVDLQKWRKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIDHIATFALNYKIKYAEDNKLIAQLDEYL
DDTFMLFSSYGINSVDLQKWRKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A8B4Z516 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A8B4Z4D4 |