Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 2827695..2828434 | Replicon | chromosome |
| Accession | NZ_LR595855 | ||
| Organism | Raoultella terrigena strain NCTC9189 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | - |
| Locus tag | FQU09_RS13735 | Protein ID | WP_076947544.1 |
| Coordinates | 2827949..2828434 (+) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | A0A085GLQ4 |
| Locus tag | FQU09_RS13730 | Protein ID | WP_032611697.1 |
| Coordinates | 2827695..2827961 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FQU09_RS13705 | 2822878..2823978 | - | 1101 | WP_123552332.1 | amino acid ABC transporter permease | - |
| FQU09_RS13710 | 2823994..2825286 | - | 1293 | WP_143967118.1 | amino acid ABC transporter permease | - |
| FQU09_RS13715 | 2825237..2826262 | - | 1026 | WP_041145578.1 | amino acid ABC transporter substrate-binding protein | - |
| FQU09_RS13720 | 2826954..2827556 | + | 603 | WP_143967119.1 | DJ-1/PfpI family protein | - |
| FQU09_RS13730 | 2827695..2827961 | + | 267 | WP_032611697.1 | DUF1778 domain-containing protein | Antitoxin |
| FQU09_RS13735 | 2827949..2828434 | + | 486 | WP_076947544.1 | GNAT family N-acetyltransferase | Toxin |
| FQU09_RS13740 | 2828539..2830071 | + | 1533 | WP_004118819.1 | IS3 family transposase | - |
| FQU09_RS13745 | 2830256..2830567 | - | 312 | Protein_2665 | DUF2255 family protein | - |
| FQU09_RS13750 | 2830810..2831907 | - | 1098 | WP_115192744.1 | alpha/beta hydrolase | - |
| FQU09_RS13755 | 2831888..2832784 | + | 897 | WP_143967120.1 | AraC family transcriptional regulator | - |
| FQU09_RS13760 | 2832802..2833050 | - | 249 | Protein_2668 | LysR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2827695..2847476 | 19781 | |
| - | flank | IS/Tn | - | - | 2828539..2830071 | 1532 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17701.48 Da Isoelectric Point: 9.8720
>T288633 WP_076947544.1 NZ_LR595855:2827949-2828434 [Raoultella terrigena]
VGHVTAPEPLSAFHQVAEFVSGETVLDDWLKHKGLKNQALGAARTFVVCKKDTKQIAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSLRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQPRTLFLRLP
Q
VGHVTAPEPLSAFHQVAEFVSGETVLDDWLKHKGLKNQALGAARTFVVCKKDTKQIAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSLRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQPRTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|