Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-RelB
Location 2712403..2712929 Replicon chromosome
Accession NZ_LR595855
Organism Raoultella terrigena strain NCTC9189

Toxin (Protein)


Gene name relE Uniprot ID A0A4U9CTU1
Locus tag FQU09_RS13105 Protein ID WP_041145684.1
Coordinates 2712642..2712929 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A6D1SE57
Locus tag FQU09_RS13100 Protein ID WP_041145685.1
Coordinates 2712403..2712642 (+) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FQU09_RS13075 2707725..2708618 - 894 WP_143967076.1 LysR family transcriptional regulator -
FQU09_RS13080 2708750..2708905 - 156 Protein_2534 diaminopimelate epimerase -
FQU09_RS13085 2709207..2710901 + 1695 WP_143967077.1 thiamine pyrophosphate-binding protein -
FQU09_RS13090 2710898..2711818 - 921 WP_143967078.1 LysR family transcriptional regulator -
FQU09_RS13095 2711888..2712206 - 319 Protein_2537 histidine phosphatase family protein -
FQU09_RS13100 2712403..2712642 + 240 WP_041145685.1 type II toxin-antitoxin system antitoxin RelB Antitoxin
FQU09_RS13105 2712642..2712929 + 288 WP_041145684.1 type II toxin-antitoxin system mRNA interferase RelE Toxin
FQU09_RS13110 2713000..2713158 + 159 WP_143967079.1 type I toxin-antitoxin system Hok family toxin -
FQU09_RS27540 2713189..2713326 - 138 WP_172620427.1 hypothetical protein -
FQU09_RS13115 2713547..2713987 + 441 WP_069476558.1 GNAT family N-acetyltransferase -
FQU09_RS13125 2714595..2715038 + 444 WP_143967080.1 acetyltransferase -
FQU09_RS13130 2715058..2715642 - 585 WP_041145681.1 XRE family transcriptional regulator -
FQU09_RS13135 2716013..2716183 - 171 Protein_2545 inositol monophosphatase -
FQU09_RS13140 2716255..2717154 - 900 WP_143967081.1 transcriptional regulator GcvA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 2707076..2721664 14588


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-79)


Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11149.10 Da        Isoelectric Point: 10.1967

>T288632 WP_041145684.1 NZ_LR595855:2712642-2712929 [Raoultella terrigena]
MAYFLDFDERALKEWRKLGSTVREQLKKKLAEVLESPRIEANKLRGVPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERAEVYSEAVKRIL

Download         Length: 288 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 9097.56 Da        Isoelectric Point: 4.5348

>AT288632 WP_041145685.1 NZ_LR595855:2712403-2712642 [Raoultella terrigena]
MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIAENERLPFKQILLSDEDAELVEIVKERLRNPKPVRVTLDEL

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4U9CTU1

Antitoxin

Source ID Structure
AlphaFold DB A0A6D1SE57

References