Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 835187..835844 | Replicon | chromosome |
| Accession | NZ_LR595855 | ||
| Organism | Raoultella terrigena strain NCTC9189 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A4V6J1V0 |
| Locus tag | FQU09_RS04075 | Protein ID | WP_041147144.1 |
| Coordinates | 835434..835844 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | - |
| Locus tag | FQU09_RS04070 | Protein ID | WP_041147145.1 |
| Coordinates | 835187..835453 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FQU09_RS04045 | 830267..831700 | - | 1434 | WP_041147149.1 | 6-phospho-beta-glucosidase | - |
| FQU09_RS04050 | 831821..832549 | - | 729 | WP_045857150.1 | MurR/RpiR family transcriptional regulator | - |
| FQU09_RS04055 | 832599..832910 | + | 312 | WP_143966477.1 | N(4)-acetylcytidine aminohydrolase | - |
| FQU09_RS04060 | 833070..833729 | + | 660 | WP_041147747.1 | hemolysin III family protein | - |
| FQU09_RS04065 | 833835..834818 | - | 984 | WP_143966478.1 | tRNA-modifying protein YgfZ | - |
| FQU09_RS04070 | 835187..835453 | + | 267 | WP_041147145.1 | FAD assembly factor SdhE | Antitoxin |
| FQU09_RS04075 | 835434..835844 | + | 411 | WP_041147144.1 | protein YgfX | Toxin |
| FQU09_RS04080 | 835893..836414 | - | 522 | WP_041147143.1 | flavodoxin FldB | - |
| FQU09_RS04085 | 836573..837469 | + | 897 | WP_041147142.1 | site-specific tyrosine recombinase XerD | - |
| FQU09_RS04090 | 837493..838206 | + | 714 | WP_076948124.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| FQU09_RS04095 | 838212..839945 | + | 1734 | WP_143966479.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16133.03 Da Isoelectric Point: 11.3523
>T288627 WP_041147144.1 NZ_LR595855:835434-835844 [Raoultella terrigena]
VVLWQSDLRISWRSQWFSLLLHGIVAAIVLLMPWPLSYTPLWLLLLSLVVFDSVRSQRRIHACQGEIKLMTDSRLRWQKA
EWEIVGMPWVINSGMLLRLRHPQTRRSQHLWVAADSMDAKEWRDLRRLVLNKPAQD
VVLWQSDLRISWRSQWFSLLLHGIVAAIVLLMPWPLSYTPLWLLLLSLVVFDSVRSQRRIHACQGEIKLMTDSRLRWQKA
EWEIVGMPWVINSGMLLRLRHPQTRRSQHLWVAADSMDAKEWRDLRRLVLNKPAQD
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|