Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 47536..48061 | Replicon | plasmid pEcMAD1 |
| Accession | NZ_LR595692 | ||
| Organism | Escherichia coli isolate EcMAD1 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | V0SSI5 |
| Locus tag | ECMAD3_RS23350 | Protein ID | WP_001159868.1 |
| Coordinates | 47756..48061 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | A0A223LLB0 |
| Locus tag | ECMAD3_RS23345 | Protein ID | WP_023909027.1 |
| Coordinates | 47536..47754 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ECMAD3_RS23330 | 45271..46404 | + | 1134 | WP_000545983.1 | DUF3800 domain-containing protein | - |
| ECMAD3_RS23335 | 46424..46708 | + | 285 | WP_000642771.1 | hypothetical protein | - |
| ECMAD3_RS23340 | 46705..46902 | - | 198 | WP_000215657.1 | hypothetical protein | - |
| ECMAD3_RS23345 | 47536..47754 | + | 219 | WP_023909027.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| ECMAD3_RS23350 | 47756..48061 | + | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| ECMAD3_RS23355 | 48062..48868 | + | 807 | WP_000016982.1 | site-specific integrase | - |
| ECMAD3_RS23360 | 49642..50397 | + | 756 | WP_000852146.1 | replication initiation protein RepE | - |
| ECMAD3_RS23365 | 50985..52151 | + | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | mph(A) / aac(3)-IId / blaTEM-1B / aadA5 / qacE / sul1 / tet(B) / aac(6')-Ib-cr / blaOXA-1 / blaCTX-M-15 / sul2 / aph(3'')-Ib / aph(6)-Id | - | 1..98473 | 98473 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T288618 WP_001159868.1 NZ_LR595692:47756-48061 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|