Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 40939..41582 | Replicon | plasmid pEcMAD1 |
Accession | NZ_LR595692 | ||
Organism | Escherichia coli isolate EcMAD1 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | B1LRW4 |
Locus tag | ECMAD3_RS23310 | Protein ID | WP_001044768.1 |
Coordinates | 40939..41355 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D2WFK3 |
Locus tag | ECMAD3_RS23315 | Protein ID | WP_001261287.1 |
Coordinates | 41352..41582 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ECMAD3_RS23295 | 36243..37175 | - | 933 | WP_000991832.1 | hypothetical protein | - |
ECMAD3_RS23300 | 37179..38174 | - | 996 | WP_000246636.1 | hypothetical protein | - |
ECMAD3_RS23305 | 38639..40777 | + | 2139 | WP_000350635.1 | AAA family ATPase | - |
ECMAD3_RS23310 | 40939..41355 | - | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
ECMAD3_RS23315 | 41352..41582 | - | 231 | WP_001261287.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
ECMAD3_RS23325 | 41889..45008 | + | 3120 | WP_023909028.1 | hypothetical protein | - |
ECMAD3_RS23330 | 45271..46404 | + | 1134 | WP_000545983.1 | DUF3800 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | mph(A) / aac(3)-IId / blaTEM-1B / aadA5 / qacE / sul1 / tet(B) / aac(6')-Ib-cr / blaOXA-1 / blaCTX-M-15 / sul2 / aph(3'')-Ib / aph(6)-Id | - | 1..98473 | 98473 | |
- | flank | IS/Tn | - | - | 35603..36106 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T288617 WP_001044768.1 NZ_LR595692:c41355-40939 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A606Q844 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QFC4 |