Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 28337..28938 Replicon plasmid pEcMAD1
Accession NZ_LR595692
Organism Escherichia coli isolate EcMAD1

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag ECMAD3_RS23265 Protein ID WP_001216034.1
Coordinates 28337..28717 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag ECMAD3_RS23270 Protein ID WP_001190712.1
Coordinates 28717..28938 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ECMAD3_RS23220 23678..23985 + 308 Protein_33 type II toxin-antitoxin system ParD family antitoxin -
ECMAD3_RS23230 24328..24510 + 183 WP_042065278.1 hypothetical protein -
ECMAD3_RS23235 24631..25371 + 741 WP_001066942.1 tyrosine-type recombinase/integrase -
ECMAD3_RS23240 25656..26633 - 978 WP_000361610.1 RepB family plasmid replication initiator protein -
ECMAD3_RS23250 27429..27842 - 414 Protein_37 DDE-type integrase/transposase/recombinase -
ECMAD3_RS23255 27766..28125 - 360 WP_001513660.1 hypothetical protein -
ECMAD3_RS23260 28153..28332 - 180 WP_001513661.1 hypothetical protein -
ECMAD3_RS23265 28337..28717 - 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
ECMAD3_RS23270 28717..28938 - 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
ECMAD3_RS23275 29121..30677 + 1557 WP_001553856.1 type I restriction-modification system subunit M -
ECMAD3_RS23280 30674..31957 + 1284 WP_001617890.1 restriction endonuclease subunit S -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid mph(A) / aac(3)-IId / blaTEM-1B / aadA5 / qacE / sul1 / tet(B) / aac(6')-Ib-cr / blaOXA-1 / blaCTX-M-15 / sul2 / aph(3'')-Ib / aph(6)-Id - 1..98473 98473
- flank IS/Tn - - 27429..27803 374


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T288616 WP_001216034.1 NZ_LR595692:c28717-28337 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT288616 WP_001190712.1 NZ_LR595692:c28938-28717 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References