Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3914288..3915089 Replicon chromosome
Accession NZ_LR595691
Organism Escherichia coli isolate EcMAD1

Toxin (Protein)


Gene name yeeV Uniprot ID A0A0E0XS49
Locus tag ECMAD3_RS18960 Protein ID WP_001094437.1
Coordinates 3914712..3915089 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A0E0XTQ1
Locus tag ECMAD3_RS18955 Protein ID WP_001390338.1
Coordinates 3914288..3914665 (+) Length 126 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ECMAD3_RS18910 3909363..3909932 - 570 WP_000148641.1 inovirus Gp2 family protein -
ECMAD3_RS18925 3910676..3910887 - 212 Protein_3651 hemolysin expression modulator Hha -
ECMAD3_RS18930 3911277..3912041 + 765 WP_162869019.1 GTPase family protein -
ECMAD3_RS18935 3912413..3913177 + 765 Protein_3653 AIDA repeat-containing protein -
ECMAD3_RS18940 3913179..3913349 + 171 Protein_3654 antirestriction protein -
ECMAD3_RS18945 3913365..3913841 + 477 WP_001186747.1 RadC family protein -
ECMAD3_RS18950 3913904..3914125 + 222 WP_000692345.1 DUF987 domain-containing protein -
ECMAD3_RS18955 3914288..3914665 + 378 WP_001390338.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
ECMAD3_RS18960 3914712..3915089 + 378 WP_001094437.1 TA system toxin CbtA family protein Toxin
ECMAD3_RS18965 3915086..3915574 + 489 WP_000761716.1 hypothetical protein -
ECMAD3_RS18970 3915594..3915791 + 198 WP_000772032.1 DUF957 domain-containing protein -
ECMAD3_RS18975 3915876..3916721 + 846 WP_001274561.1 DUF4942 domain-containing protein -
ECMAD3_RS18980 3916956..3917084 + 129 Protein_3662 virulence RhuM family protein -
ECMAD3_RS18985 3917514..3918698 + 1185 WP_001172877.1 sugar efflux transporter -
ECMAD3_RS18990 3918809..3919732 + 924 WP_000535960.1 carboxylate/amino acid/amine transporter -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13986.90 Da        Isoelectric Point: 7.3223

>T288614 WP_001094437.1 NZ_LR595691:3914712-3915089 [Escherichia coli]
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 126 a.a.        Molecular weight: 13745.44 Da        Isoelectric Point: 5.0463

>AT288614 WP_001390338.1 NZ_LR595691:3914288-3914665 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYAYLAVYPTPAEPAITV

Download         Length: 378 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0XS49

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0XTQ1

References