Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 2619249..2619874 | Replicon | chromosome |
| Accession | NZ_LR595691 | ||
| Organism | Escherichia coli isolate EcMAD1 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | ECMAD3_RS12645 | Protein ID | WP_000911330.1 |
| Coordinates | 2619249..2619647 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | U9XQV3 |
| Locus tag | ECMAD3_RS12650 | Protein ID | WP_000450524.1 |
| Coordinates | 2619647..2619874 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ECMAD3_RS12625 | 2614966..2615712 | + | 747 | WP_053906593.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| ECMAD3_RS12630 | 2615794..2616135 | - | 342 | Protein_2437 | esterase | - |
| ECMAD3_RS12635 | 2616209..2618224 | - | 2016 | WP_000829323.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
| ECMAD3_RS12640 | 2618239..2619102 | - | 864 | WP_001267507.1 | neutral zinc metallopeptidase | - |
| ECMAD3_RS12645 | 2619249..2619647 | - | 399 | WP_000911330.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| ECMAD3_RS12650 | 2619647..2619874 | - | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| ECMAD3_RS12655 | 2620028..2620741 | - | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| ECMAD3_RS12660 | 2620954..2621988 | - | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
| ECMAD3_RS12665 | 2622005..2622883 | - | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| ECMAD3_RS12670 | 2623029..2623601 | + | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
| ECMAD3_RS12675 | 2623601..2624071 | + | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T288607 WP_000911330.1 NZ_LR595691:c2619647-2619249 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|