Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 1157860..1158704 | Replicon | chromosome |
Accession | NZ_LR595691 | ||
Organism | Escherichia coli isolate EcMAD1 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | B1LJY4 |
Locus tag | ECMAD3_RS05540 | Protein ID | WP_000854686.1 |
Coordinates | 1158321..1158704 (+) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A8E0J1S3 |
Locus tag | ECMAD3_RS05535 | Protein ID | WP_001285602.1 |
Coordinates | 1157860..1158240 (+) | Length | 127 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ECMAD3_RS05495 | 1154108..1154563 | + | 456 | WP_000581506.1 | hypothetical protein | - |
ECMAD3_RS05500 | 1154664..1154872 | + | 209 | Protein_1050 | DUF905 family protein | - |
ECMAD3_RS05510 | 1154973..1155794 | + | 822 | WP_001761104.1 | DUF945 domain-containing protein | - |
ECMAD3_RS05515 | 1155886..1156371 | + | 486 | WP_000214307.1 | antirestriction protein | - |
ECMAD3_RS05520 | 1156387..1156863 | + | 477 | WP_001186726.1 | RadC family protein | - |
ECMAD3_RS05525 | 1156926..1157147 | + | 222 | WP_000692298.1 | DUF987 domain-containing protein | - |
ECMAD3_RS05530 | 1157166..1157849 | + | 684 | WP_000086768.1 | hypothetical protein | - |
ECMAD3_RS05535 | 1157860..1158240 | + | 381 | WP_001285602.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
ECMAD3_RS05540 | 1158321..1158704 | + | 384 | WP_000854686.1 | TA system toxin CbtA family protein | Toxin |
ECMAD3_RS05545 | 1158701..1159189 | + | 489 | WP_032180032.1 | hypothetical protein | - |
ECMAD3_RS05550 | 1159206..1159403 | + | 198 | WP_000839253.1 | DUF957 domain-containing protein | - |
ECMAD3_RS05555 | 1159488..1160329 | + | 842 | Protein_1060 | DUF4942 domain-containing protein | - |
ECMAD3_RS05565 | 1160800..1161738 | + | 939 | WP_000351311.1 | glyoxylate/hydroxypyruvate reductase GhrA | - |
ECMAD3_RS05570 | 1161793..1162530 | + | 738 | WP_000283664.1 | zinc-binding phosphatase | - |
ECMAD3_RS05575 | 1162554..1163108 | + | 555 | WP_001001902.1 | molecular chaperone YcdY | - |
ECMAD3_RS05580 | 1163210..1163701 | + | 492 | WP_001297187.1 | DUF1097 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14272.28 Da Isoelectric Point: 6.8614
>T288600 WP_000854686.1 NZ_LR595691:1158321-1158704 [Escherichia coli]
MKTLPDTHVRAASRCPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGAPSSQLINSIDILRARRATGLMTRDNYRMVNNITLGKHPEEAKQ
MKTLPDTHVRAASRCPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGAPSSQLINSIDILRARRATGLMTRDNYRMVNNITLGKHPEEAKQ
Download Length: 384 bp
Antitoxin
Download Length: 127 a.a. Molecular weight: 13938.69 Da Isoelectric Point: 5.0823
>AT288600 WP_001285602.1 NZ_LR595691:1157860-1158240 [Escherichia coli]
VSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
VSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
Download Length: 381 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|