Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicB(antitoxin) |
| Location | 147834..148436 | Replicon | plasmid 4 |
| Accession | NZ_LR594692 | ||
| Organism | Variovorax sp. WDL1 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A2J7V4Q8 |
| Locus tag | E5P1_RS40190 | Protein ID | WP_068673364.1 |
| Coordinates | 148260..148436 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A2J7V4M7 |
| Locus tag | E5P1_RS40185 | Protein ID | WP_068673366.1 |
| Coordinates | 147834..148250 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E5P1_RS40150 | 143875..144534 | - | 660 | WP_068685911.1 | CoA transferase | - |
| E5P1_RS40155 | 144578..145297 | - | 720 | WP_102906325.1 | IS6 family transposase | - |
| E5P1_RS40160 | 145402..145689 | + | 288 | WP_068684376.1 | CopG family ribbon-helix-helix protein | - |
| E5P1_RS40165 | 145677..146000 | + | 324 | WP_068684378.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| E5P1_RS40170 | 146376..146534 | - | 159 | WP_102906327.1 | integrase core domain-containing protein | - |
| E5P1_RS40175 | 146603..147322 | + | 720 | WP_102906325.1 | IS6 family transposase | - |
| E5P1_RS40180 | 147345..147476 | - | 132 | WP_162487269.1 | helix-turn-helix domain-containing protein | - |
| E5P1_RS40185 | 147834..148250 | - | 417 | WP_068673366.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| E5P1_RS40190 | 148260..148436 | - | 177 | WP_068673364.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| E5P1_RS40195 | 148937..149098 | - | 162 | WP_157103359.1 | hypothetical protein | - |
| E5P1_RS40200 | 149122..150357 | - | 1236 | WP_068678855.1 | ISL3 family transposase | - |
| E5P1_RS40205 | 151011..151268 | + | 258 | WP_068683861.1 | hypothetical protein | - |
| E5P1_RS40210 | 152214..152564 | - | 351 | WP_146039727.1 | hypothetical protein | - |
| E5P1_RS40215 | 152587..153225 | - | 639 | WP_068683853.1 | YkgJ family cysteine cluster protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..207894 | 207894 | |
| - | flank | IS/Tn | - | - | 149122..150357 | 1235 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6575.71 Da Isoelectric Point: 10.9005
>T288597 WP_068673364.1 NZ_LR594692:c148436-148260 [Variovorax sp. WDL1]
MKTSEFKRFLASKGAKFAEGAKHTKVYLGGRQCTLPRHSKEIGEGLRKSILRQLEIKD
MKTSEFKRFLASKGAKFAEGAKHTKVYLGGRQCTLPRHSKEIGEGLRKSILRQLEIKD
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15317.87 Da Isoelectric Point: 9.9436
>AT288597 WP_068673366.1 NZ_LR594692:c148250-147834 [Variovorax sp. WDL1]
MFSYPARVTRDGDRYMVTFPDIPEALTGAKSRAEAIELAADALTTAMDFYFEDRRPVPMPSPPKRGQIAVDLPPSVSAKV
LLLNEMIAQGKRPAELARLMHARPQEVTRLVDLHHPTKIDTVAAALRAMGKRLELRLA
MFSYPARVTRDGDRYMVTFPDIPEALTGAKSRAEAIELAADALTTAMDFYFEDRRPVPMPSPPKRGQIAVDLPPSVSAKV
LLLNEMIAQGKRPAELARLMHARPQEVTRLVDLHHPTKIDTVAAALRAMGKRLELRLA
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J7V4Q8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J7V4M7 |