Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ParE-CopA/ParE-RHH
Location 145402..146000 Replicon plasmid 4
Accession NZ_LR594692
Organism Variovorax sp. WDL1

Toxin (Protein)


Gene name parE Uniprot ID A0A2J7V4N2
Locus tag E5P1_RS40165 Protein ID WP_068684378.1
Coordinates 145677..146000 (+) Length 108 a.a.

Antitoxin (Protein)


Gene name copA Uniprot ID A0A2J7V4P6
Locus tag E5P1_RS40160 Protein ID WP_068684376.1
Coordinates 145402..145689 (+) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
E5P1_RS40135 140469..140771 + 303 WP_068685913.1 hypothetical protein -
E5P1_RS40140 141168..142289 - 1122 WP_068685909.1 DNA-binding protein -
E5P1_RS40145 142400..143563 + 1164 WP_102906331.1 site-specific integrase -
E5P1_RS40150 143875..144534 - 660 WP_068685911.1 CoA transferase -
E5P1_RS40155 144578..145297 - 720 WP_102906325.1 IS6 family transposase -
E5P1_RS40160 145402..145689 + 288 WP_068684376.1 CopG family ribbon-helix-helix protein Antitoxin
E5P1_RS40165 145677..146000 + 324 WP_068684378.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
E5P1_RS40170 146376..146534 - 159 WP_102906327.1 integrase core domain-containing protein -
E5P1_RS40175 146603..147322 + 720 WP_102906325.1 IS6 family transposase -
E5P1_RS40180 147345..147476 - 132 WP_162487269.1 helix-turn-helix domain-containing protein -
E5P1_RS40185 147834..148250 - 417 WP_068673366.1 type II toxin-antitoxin system HicB family antitoxin -
E5P1_RS40190 148260..148436 - 177 WP_068673364.1 type II toxin-antitoxin system HicA family toxin -
E5P1_RS40195 148937..149098 - 162 WP_157103359.1 hypothetical protein -
E5P1_RS40200 149122..150357 - 1236 WP_068678855.1 ISL3 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..207894 207894
- flank IS/Tn - - 149122..150357 1235


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-96)

Antitoxin

Ribbon-helix-helix protein, CopG

(10-45)


Sequences

Toxin        


Download         Length: 108 a.a.        Molecular weight: 11900.61 Da        Isoelectric Point: 9.8130

>T288596 WP_068684378.1 NZ_LR594692:145677-146000 [Variovorax sp. WDL1]
MPQVRFAPAALRDLQRLREFLRPKNPAAAKRAGETIIKAVQVLRQQPMVGRPVQDLPPEYREWVIDFGASGYVALYHYAG
EGDVVTVLALRHQREVGYEPGSSASGN

Download         Length: 324 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10923.42 Da        Isoelectric Point: 6.3280

>AT288596 WP_068684376.1 NZ_LR594692:145402-145689 [Variovorax sp. WDL1]
MNTAISPTPVKLDPELKVRLKRLATARHRAPHWLMREAIAQYVDREEKRQALHQDAVAAWQEFEETGLHVTGNEVMAWLE
TWGTEDELPAPACHK

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2J7V4N2

Antitoxin

Source ID Structure
AlphaFold DB A0A2J7V4P6

References