Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapB(antitoxin)
Location 367727..368304 Replicon plasmid 3
Accession NZ_LR594691
Organism Variovorax sp. WDL1

Toxin (Protein)


Gene name vapC Uniprot ID A0A2J7VE76
Locus tag E5P1_RS38390 Protein ID WP_068684071.1
Coordinates 367930..368304 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag E5P1_RS38385 Protein ID WP_068684153.1
Coordinates 367727..367933 (+) Length 69 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
E5P1_RS38365 363657..364097 - 441 WP_083944733.1 hypothetical protein -
E5P1_RS38370 364564..365070 - 507 Protein_349 hypothetical protein -
E5P1_RS38375 365275..365868 + 594 WP_068684155.1 TetR/AcrR family transcriptional regulator -
E5P1_RS38380 366361..367098 - 738 WP_068684073.1 DUF305 domain-containing protein -
E5P1_RS38385 367727..367933 + 207 WP_068684153.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
E5P1_RS38390 367930..368304 + 375 WP_068684071.1 type II toxin-antitoxin system VapC family toxin Toxin
E5P1_RS38395 368291..368602 + 312 WP_146039622.1 hypothetical protein -
E5P1_RS38400 368626..369756 + 1131 WP_083944732.1 tyrosine-type recombinase/integrase -
E5P1_RS38405 369783..370175 + 393 WP_146039621.1 hypothetical protein -
E5P1_RS38410 370395..370640 + 246 WP_068684067.1 hypothetical protein -
E5P1_RS38415 371375..371554 - 180 WP_068684065.1 DUF3606 domain-containing protein -
E5P1_RS38420 371794..372426 - 633 WP_146039620.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..565873 565873


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Bacterial antitoxin of type II TA system, VapB

(1-43)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13542.72 Da        Isoelectric Point: 5.0940

>T288595 WP_068684071.1 NZ_LR594691:367930-368304 [Variovorax sp. WDL1]
MSVLVDTSVWIDHFRSGNAALANLVGLDLALTHPMVIVELACGTPPSPRERTLGSLSLLRTCNQATLDEVLELIERERLD
GLGCGLVDMALLASTLITPGARLWTLDRRLFELAQRFDVAHGLH

Download         Length: 375 bp

Antitoxin


Download         Length: 69 a.a.        Molecular weight: 7587.72 Da        Isoelectric Point: 5.0807

>AT288595 WP_068684153.1 NZ_LR594691:367727-367933 [Variovorax sp. WDL1]
MRTTVTIEDSLFEKALEMADPEMDKAEIFREAIRTFVRVQAGKRLIALGGTAPDIQDVPRRRGEPVSG

Download         Length: 207 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2J7VE76

Antitoxin

Source ID Structure

References