Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicB(antitoxin)
Location 326276..326878 Replicon plasmid 3
Accession NZ_LR594691
Organism Variovorax sp. WDL1

Toxin (Protein)


Gene name hicA Uniprot ID A0A2J7VEB9
Locus tag E5P1_RS38175 Protein ID WP_068681284.1
Coordinates 326702..326878 (-) Length 59 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A2J7VED7
Locus tag E5P1_RS38170 Protein ID WP_068681282.1
Coordinates 326276..326692 (-) Length 139 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
E5P1_RS38110 321300..321854 + 555 WP_068681290.1 plasmid pRiA4b ORF-3 family protein -
E5P1_RS38115 321868..322116 + 249 WP_102906039.1 hypothetical protein -
E5P1_RS38120 322272..322463 + 192 WP_068681266.1 hypothetical protein -
E5P1_RS38125 322541..323086 - 546 WP_083944557.1 helix-turn-helix domain-containing protein -
E5P1_RS38130 323061..323381 - 321 WP_068681270.1 type II toxin-antitoxin system RelE/ParE family toxin -
E5P1_RS38135 323491..323790 - 300 WP_146039650.1 hypothetical protein -
E5P1_RS38140 324210..324419 + 210 WP_068681275.1 hypothetical protein -
E5P1_RS38145 324737..325057 + 321 WP_068681277.1 hypothetical protein -
E5P1_RS38150 325080..325295 + 216 WP_068681279.1 hypothetical protein -
E5P1_RS38155 325358..325729 + 372 WP_146039651.1 hypothetical protein -
E5P1_RS38160 325739..325882 + 144 WP_157103456.1 hypothetical protein -
E5P1_RS38165 325905..326072 - 168 WP_157103457.1 hypothetical protein -
E5P1_RS38170 326276..326692 - 417 WP_068681282.1 antitoxin Antitoxin
E5P1_RS38175 326702..326878 - 177 WP_068681284.1 type II toxin-antitoxin system HicA family toxin Toxin
E5P1_RS38180 327021..327871 + 851 Protein_311 DMT family transporter -
E5P1_RS38190 329797..330591 + 795 WP_068684135.1 SDR family oxidoreductase -
E5P1_RS38195 330808..331056 - 249 WP_068684133.1 hypothetical protein -
E5P1_RS38200 331053..331223 - 171 WP_157103496.1 hypothetical protein -
E5P1_RS38205 331220..331357 - 138 WP_157103495.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..565873 565873


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(4-56)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 59 a.a.        Molecular weight: 6619.80 Da        Isoelectric Point: 11.2836

>T288594 WP_068681284.1 NZ_LR594691:c326878-326702 [Variovorax sp. WDL1]
MKTSEFKRFLASKGARFVEGSKHTKVYLGTKQTMLPRHSKEIGEGLRKSILRQLGIKD

Download         Length: 177 bp

Antitoxin


Download         Length: 139 a.a.        Molecular weight: 15201.77 Da        Isoelectric Point: 7.3187

>AT288594 WP_068681282.1 NZ_LR594691:c326692-326276 [Variovorax sp. WDL1]
MFSYPARVTRDGDGYLVTFPDIPEAVTGAKDRVEAIELAADALTTAMDFYFEDRRPVPMPSALKRGQVAIDLPPSVAVKV
LLLNEMIAQGKRPAELARLMHARPQEVTRLVDLHHPTKIDTVAAALLAMGKRLELRLA

Download         Length: 417 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2J7VEB9

Antitoxin

Source ID Structure
AlphaFold DB A0A2J7VED7

References