Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 277668..278239 | Replicon | plasmid 2 |
Accession | NZ_LR594690 | ||
Organism | Variovorax sp. WDL1 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | E5P1_RS33740 | Protein ID | WP_068674408.1 |
Coordinates | 277898..278239 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A2J7VJZ3 |
Locus tag | E5P1_RS33735 | Protein ID | WP_068674410.1 |
Coordinates | 277668..277901 (+) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E5P1_RS33705 | 272809..273036 | + | 228 | WP_146039514.1 | hypothetical protein | - |
E5P1_RS33710 | 273306..273698 | + | 393 | WP_083944158.1 | DUF2924 domain-containing protein | - |
E5P1_RS33715 | 274250..275356 | - | 1107 | WP_083944157.1 | acyltransferase | - |
E5P1_RS33720 | 275338..275982 | - | 645 | WP_068674416.1 | hypothetical protein | - |
E5P1_RS33725 | 276009..276428 | - | 420 | WP_068674414.1 | hypothetical protein | - |
E5P1_RS33730 | 276537..277514 | + | 978 | WP_068674412.1 | WYL domain-containing protein | - |
E5P1_RS33735 | 277668..277901 | + | 234 | WP_068674410.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
E5P1_RS33740 | 277898..278239 | + | 342 | WP_068674408.1 | endoribonuclease MazF | Toxin |
E5P1_RS33745 | 278469..280142 | - | 1674 | WP_068674406.1 | hypothetical protein | - |
E5P1_RS33750 | 280475..281380 | - | 906 | WP_146039517.1 | hypothetical protein | - |
E5P1_RS33755 | 282012..282233 | - | 222 | WP_146039518.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..816468 | 816468 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12034.87 Da Isoelectric Point: 9.2734
>T288592 WP_068674408.1 NZ_LR594690:277898-278239 [Variovorax sp. WDL1]
VTGAYVPGRGDVVWLDFDPQAGHEQAGRRPALVLSPATYNGKSGLMLCCPVTNQAKGYPFEVPVTPSSGKVTGVALTDQV
RCLDWRSRNASKFASVTTKCTLDVSAKVKLLLP
VTGAYVPGRGDVVWLDFDPQAGHEQAGRRPALVLSPATYNGKSGLMLCCPVTNQAKGYPFEVPVTPSSGKVTGVALTDQV
RCLDWRSRNASKFASVTTKCTLDVSAKVKLLLP
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|