Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VapB |
| Location | 5419755..5420322 | Replicon | chromosome |
| Accession | NZ_LR594689 | ||
| Organism | Variovorax sp. WDL1 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | E5P1_RS26230 | Protein ID | WP_068678114.1 |
| Coordinates | 5419755..5420126 (-) | Length | 124 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | E5P1_RS26235 | Protein ID | WP_083944382.1 |
| Coordinates | 5420113..5420322 (-) | Length | 70 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E5P1_RS26200 | 5414842..5415699 | + | 858 | WP_068675210.1 | chemotaxis protein CheR | - |
| E5P1_RS26205 | 5416616..5417227 | + | 612 | WP_068678107.1 | chemoreceptor glutamine deamidase CheD | - |
| E5P1_RS26210 | 5417224..5418300 | + | 1077 | WP_068678106.1 | chemotaxis response regulator protein-glutamate methylesterase | - |
| E5P1_RS26215 | 5418340..5418738 | + | 399 | WP_068678105.1 | chemotaxis response regulator CheY | - |
| E5P1_RS26220 | 5418740..5419378 | + | 639 | WP_068678104.1 | protein phosphatase CheZ | - |
| E5P1_RS26225 | 5419496..5419723 | + | 228 | WP_068678103.1 | hypothetical protein | - |
| E5P1_RS26230 | 5419755..5420126 | - | 372 | WP_068678114.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| E5P1_RS26235 | 5420113..5420322 | - | 210 | WP_083944382.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| E5P1_RS26240 | 5420515..5421657 | + | 1143 | WP_068678102.1 | flagellar type III secretion system protein FlhB | - |
| E5P1_RS26245 | 5421654..5423750 | + | 2097 | WP_068678101.1 | flagellar biosynthesis protein FlhA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13564.77 Da Isoelectric Point: 6.3280
>T288590 WP_068678114.1 NZ_LR594689:c5420126-5419755 [Variovorax sp. WDL1]
MILVDTSVWIDHLARGDSGLQSLLEEGEVLMHPYIVAEIALGSLTRRDETVGALQALPEVTVARHVEVMAFLGNERLFGI
GIGYVDLHLLAATRLAAGTKLWTRDRRLLQAALRLDLARFPAH
MILVDTSVWIDHLARGDSGLQSLLEEGEVLMHPYIVAEIALGSLTRRDETVGALQALPEVTVARHVEVMAFLGNERLFGI
GIGYVDLHLLAATRLAAGTKLWTRDRRLLQAALRLDLARFPAH
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|