Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-VagC |
Location | 609555..610276 | Replicon | chromosome |
Accession | NZ_LR594689 | ||
Organism | Variovorax sp. WDL1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A2J7VZ91 |
Locus tag | E5P1_RS02985 | Protein ID | WP_068679468.1 |
Coordinates | 609824..610276 (+) | Length | 151 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A2J7VZ83 |
Locus tag | E5P1_RS02980 | Protein ID | WP_068679470.1 |
Coordinates | 609555..609827 (+) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E5P1_RS02965 | 604732..605217 | - | 486 | WP_068679474.1 | 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase | - |
E5P1_RS02970 | 605237..605941 | - | 705 | WP_068679598.1 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase | - |
E5P1_RS02975 | 606046..609540 | + | 3495 | WP_068679472.1 | transcription-repair coupling factor | - |
E5P1_RS02980 | 609555..609827 | + | 273 | WP_068679470.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
E5P1_RS02985 | 609824..610276 | + | 453 | WP_068679468.1 | PIN domain-containing protein | Toxin |
E5P1_RS02990 | 610269..610967 | + | 699 | WP_068679595.1 | phosphoserine phosphatase SerB | - |
E5P1_RS02995 | 611102..612073 | + | 972 | WP_068679466.1 | tripartite tricarboxylate transporter substrate binding protein | - |
E5P1_RS03000 | 612077..612544 | + | 468 | WP_068679464.1 | tripartite tricarboxylate transporter TctB family protein | - |
E5P1_RS03005 | 612555..614057 | + | 1503 | WP_068679463.1 | tripartite tricarboxylate transporter permease | - |
E5P1_RS03010 | 614063..615127 | + | 1065 | WP_068679462.1 | Ldh family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 151 a.a. Molecular weight: 16420.70 Da Isoelectric Point: 6.3323
>T288586 WP_068679468.1 NZ_LR594689:609824-610276 [Variovorax sp. WDL1]
MSAEAATNSLRLLDTNTVFELMRHPGGKVAARLRRLAQEQPDGRVCTSAVVDCELRFGVNRKGSARLADAYTRAMSVIEV
RDLPAAVAPIYADIRTQLEQVGKPIGPNDLLIAAHALALDATLVTHNESEFRRVPGLVVENWLESAHEHE
MSAEAATNSLRLLDTNTVFELMRHPGGKVAARLRRLAQEQPDGRVCTSAVVDCELRFGVNRKGSARLADAYTRAMSVIEV
RDLPAAVAPIYADIRTQLEQVGKPIGPNDLLIAAHALALDATLVTHNESEFRRVPGLVVENWLESAHEHE
Download Length: 453 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J7VZ91 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J7VZ83 |