Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relE-dinJ/YafQ-RelB
Location 90771..91302 Replicon plasmid 3
Accession NZ_LR594677
Organism Variovorax sp. PBS-H4

Toxin (Protein)


Gene name relE Uniprot ID I2ALI9
Locus tag E5CHR_RS31510 Protein ID WP_011114071.1
Coordinates 90771..91052 (-) Length 94 a.a.

Antitoxin (Protein)


Gene name dinJ Uniprot ID I2ALI8
Locus tag E5CHR_RS31515 Protein ID WP_011114070.1
Coordinates 91039..91302 (-) Length 88 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
E5CHR_RS31500 86267..86893 + 627 WP_068683781.1 lytic transglycosylase domain-containing protein -
E5CHR_RS31505 87139..90054 - 2916 WP_003158660.1 Tn3-like element IS1071 family transposase -
E5CHR_RS31510 90771..91052 - 282 WP_011114071.1 type II toxin-antitoxin system YafQ family toxin Toxin
E5CHR_RS31515 91039..91302 - 264 WP_011114070.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
E5CHR_RS31520 91475..91903 + 429 WP_011114069.1 antirestriction protein -
E5CHR_RS31525 91903..92166 + 264 WP_011296181.1 hypothetical protein -
E5CHR_RS31530 92178..93386 + 1209 WP_011114068.1 hypothetical protein -
E5CHR_RS31535 93403..93660 + 258 WP_011114067.1 hypothetical protein -
E5CHR_RS31540 93818..94054 + 237 WP_011114066.1 stable inheritance protein KleA -
E5CHR_RS31545 94263..94589 + 327 WP_011114065.1 hypothetical protein -
E5CHR_RS31550 94591..94920 + 330 WP_011114064.1 DUF2761 domain-containing protein -
E5CHR_RS31555 95027..95335 + 309 WP_011114062.1 KorA protein -
E5CHR_RS31560 95332..96096 + 765 WP_011114061.1 ParA family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - virB4 / virB11 1..104859 104859
- flank IS/Tn - - 87139..90054 2915


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(1-91)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-83)


Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 10743.19 Da        Isoelectric Point: 7.4750

>T288584 WP_011114071.1 NZ_LR594677:c91052-90771 [Variovorax sp. PBS-H4]
MRQIERTGQFKRDYKREAKGQHRATLDADLVPVLVALADDQPLEPRHRDHALTGDWKDHRDCHVKPDLVLIYQKPDADTL
RLVRLGSHSELGL

Download         Length: 282 bp

Antitoxin


Download         Length: 88 a.a.        Molecular weight: 9255.82 Da        Isoelectric Point: 5.7905

>AT288584 WP_011114070.1 NZ_LR594677:c91302-91039 [Variovorax sp. PBS-H4]
MAANQLVQTRIDGAIKEEAAAVLAAMGLTVSDAVRLLLTKVAQDKALPFEPLIPNATTIEAMKEARKGKLPRFATVNDLM
ADLHAAD

Download         Length: 264 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1U9V4I5

Antitoxin

Source ID Structure
AlphaFold DB A0A1U9V3I2

References