Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 1984533..1985100 | Replicon | chromosome |
Accession | NZ_LR594675 | ||
Organism | Variovorax sp. PBS-H4 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | E5CHR_RS09520 | Protein ID | WP_162579453.1 |
Coordinates | 1984533..1984904 (-) | Length | 124 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | E5CHR_RS09525 | Protein ID | WP_162579454.1 |
Coordinates | 1984891..1985100 (-) | Length | 70 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E5CHR_RS09495 | 1980775..1981632 | + | 858 | WP_162579449.1 | chemotaxis protein CheR | - |
E5CHR_RS09500 | 1981739..1982350 | + | 612 | WP_162579450.1 | chemoreceptor glutamine deamidase CheD | - |
E5CHR_RS09505 | 1982347..1983426 | + | 1080 | WP_174255710.1 | chemotaxis response regulator protein-glutamate methylesterase | - |
E5CHR_RS09510 | 1983454..1983852 | + | 399 | WP_162579451.1 | chemotaxis response regulator CheY | - |
E5CHR_RS09515 | 1983854..1984492 | + | 639 | WP_162579452.1 | protein phosphatase CheZ | - |
E5CHR_RS09520 | 1984533..1984904 | - | 372 | WP_162579453.1 | PIN domain nuclease | Toxin |
E5CHR_RS09525 | 1984891..1985100 | - | 210 | WP_162579454.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
E5CHR_RS09530 | 1985291..1986436 | + | 1146 | WP_162579455.1 | flagellar type III secretion system protein FlhB | - |
E5CHR_RS09535 | 1986433..1988529 | + | 2097 | WP_162579456.1 | flagellar biosynthesis protein FlhA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13596.86 Da Isoelectric Point: 6.9899
>T288582 WP_162579453.1 NZ_LR594675:c1984904-1984533 [Variovorax sp. PBS-H4]
MILVDTSVWIDHLARGDSRLQSLLEEGEVLMHPYIVAEIALGSLTRRKETVGALQALPEIPAARHDEVMAFLGNERLFGL
GIGYVDLHLLAATRLAVGTKLWTRDRRLLQAALKFNLAAFAAH
MILVDTSVWIDHLARGDSRLQSLLEEGEVLMHPYIVAEIALGSLTRRKETVGALQALPEIPAARHDEVMAFLGNERLFGL
GIGYVDLHLLAATRLAVGTKLWTRDRRLLQAALKFNLAAFAAH
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|