Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) FicTA/Fic(toxin)
Location 36504..37297 Replicon plasmid 4
Accession NZ_LR594674
Organism Variovorax sp. PBL-E5

Toxin (Protein)


Gene name VbhT Uniprot ID Q6QHR6
Locus tag WDLP6_RS34770 Protein ID WP_011171676.1
Coordinates 36689..37297 (+) Length 203 a.a.

Antitoxin (Protein)


Gene name VbhA Uniprot ID A0A8B6LZM3
Locus tag WDLP6_RS34765 Protein ID WP_011171677.1
Coordinates 36504..36692 (+) Length 63 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
WDLP6_RS34730 31698..31955 + 258 WP_011171685.1 stable inheritance protein KleA -
WDLP6_RS34735 32072..32395 + 324 WP_075122821.1 protein kleE -
WDLP6_RS34740 32397..32918 + 522 WP_162572163.1 DUF2761 domain-containing protein -
WDLP6_RS34745 33080..33388 + 309 WP_015063537.1 transcriptional regulator KorA -
WDLP6_RS34750 33385..34158 + 774 WP_162572150.1 ParA family protein -
WDLP6_RS34755 34155..35228 + 1074 WP_011171679.1 ParB/RepB/Spo0J family partition protein -
WDLP6_RS34760 35423..36439 + 1017 WP_011171678.1 DNA-binding protein -
WDLP6_RS34765 36504..36692 + 189 WP_011171677.1 antitoxin VbhA family protein Antitoxin
WDLP6_RS34770 36689..37297 + 609 WP_011171676.1 Fic/DOC family protein Toxin
WDLP6_RS34775 37314..37658 + 345 WP_015063536.1 hypothetical protein -
WDLP6_RS34780 37710..38339 + 630 WP_162572165.1 hypothetical protein -
WDLP6_RS34785 38410..38847 - 438 WP_011171734.1 conjugal transfer protein TraM -
WDLP6_RS34790 38847..39572 - 726 WP_011171733.1 conjugal transfer protein TraL -
WDLP6_RS34795 39572..39970 - 399 WP_011171732.1 TraK family protein -
WDLP6_RS34800 40395..40751 + 357 WP_162572166.1 conjugal transfer transcriptional regulator TraJ -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..71037 71037


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(55-150)

Antitoxin

Antitoxin VbhA

(10-56)


Sequences

Toxin        


Download         Length: 203 a.a.        Molecular weight: 22398.22 Da        Isoelectric Point: 7.4661

>T288581 WP_011171676.1 NZ_LR594674:36689-37297 [Variovorax sp. PBL-E5]
MKYAGDRGDPYLDSETGVLRNLLGIKEQGGLDKAESTLSFLRASELREQPVKGKFDLAHLQRIHKRLFGDVYDWAGQIRQ
VEISKGSTMFARQVAIQSAAQQLFGQLAKEQLLRGLDADEFSKRAGHYLGEINVLHPFREGNGRTQREFIGQLAQQAGHR
IDWSGVSQASMTQASIEAYNGDSSGMAGLIRAGMPDQLFFNP

Download         Length: 609 bp

Antitoxin


Download         Length: 63 a.a.        Molecular weight: 6904.79 Da        Isoelectric Point: 4.4982

>AT288581 WP_011171677.1 NZ_LR594674:36504-36692 [Variovorax sp. PBL-E5]
MIAEQEQTERRAVVQSALASQRIEGLEPDAQAVADAERWARGEMTIGAAVDQYKARMRLEMA

Download         Length: 189 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A8B6M0K6

Antitoxin

Source ID Structure
AlphaFold DB A0A8B6LZM3

References